KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_03600Help
Entry
I653_03600        CDS       T02520                                 

Definition
putative glycosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:bsy00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    I653_03600
  Lipid metabolism
   00561 Glycerolipid metabolism
    I653_03600
   00600 Sphingolipid metabolism
    I653_03600
Enzymes [BR:bsy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     I653_03600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
754684..756024
Genome map
AA seq 446 aa AA seqDB search
MFHISTLDQIKIAYIGGGSQGWARSLMSDLSIDERMSGTVALYDLDFEAAQKNEVIGNHS
GNGRWRYEAVSTLKKALSAADIVIISILPGSLDDMEVDVHLPERCGIYQSVGDTVGPGGI
IRGLRAVPIFAEIARAIRDYAPESWVINYTNPMSVCTRVLYKVFPGIKAIGCCHEVFGTQ
KLLVEMVTERLGIEVPRREDIRVNVLGINHFTWITKASYRHIDLLPIFREFSAHYGESGY
ELEGESWRDSVFCSAHRVAFDLFETYGAIPAAGDRHLAEFLPGPYLKQPEVWRFHLTPIS
FRKQDRAEKRQETERLIVQQRGVAEKASGEEGVNIIAALLGLGELVTNVNMPNQGQVSNL
PIQAIVETNAFITRNRVQPIFSGALPKGVEMLAARHISNQEAVSEAGLTKDTGLAFQAFL
NDPLVRIDRSDAEQLFNDMLQCTMQR
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
gtgtttcatatcagtacattagatcagattaagattgcctatatcggcggggggtcccaa
ggctgggccagaagcctgatgagtgatttgtcgattgatgaacggatgtcaggcacggtg
gcgctctatgatcttgattttgaagccgctcagaaaaatgaagtgatcggcaatcacagc
gggaacggcagatggagatatgaggctgtttctactttgaaaaaggcgttatcagccgct
gatatcgtcattatttccattttgccgggatcactggatgatatggaagtcgatgtccac
ttgcctgagcgctgcggtatttatcagtctgtaggtgatactgtcgggcccggagggatc
atcaggggcttgcgtgctgtgccgatatttgcggaaattgcccgggcaataagagactac
gcacctgaatcatgggtcattaattatacaaacccgatgtctgtctgtacaagagtgctg
tataaagtgtttcccggaatcaaagcgattggctgctgccacgaggtatttgggacgcaa
aagctattggtggaaatggtcacggaaaggctggggatagaggtgccgcggcgtgaggat
atccgcgttaatgtgctcggcattaaccattttacatggatcacaaaagcctcttaccgc
catattgacctgctgcctatattccgtgaattcagcgcgcactatggggaatcaggatat
gagctggagggggaaagctggagggacagcgtcttttgttcggcacaccgtgttgcgttt
gatttatttgaaacgtatggcgccatccctgctgcaggagacaggcatctggcagagttt
cttcccggcccatacctcaaacagcctgaagtatggagatttcatctcacacctatatca
ttcagaaaacaagacagagctgagaaacgacaagaaacagaacggttgatcgtgcaacaa
cggggcgttgctgagaaagcttcgggagaagaaggcgtgaacatcatagcggctcttctc
ggattgggtgaactcgtcacaaatgtaaatatgccgaatcaaggccaggtctcaaacctt
cctatacaagccattgtcgaaacaaacgcattcatcacaaggaaccgtgtccagccgatt
ttttccggagcgcttccgaaaggtgtggaaatgctggcggctaggcatatatccaatcaa
gaggcagtgtcggaagcaggtctaacaaaggatactggcctcgcgtttcaagctttcctc
aatgacccgcttgtcaggattgaccgcagtgatgcagagcagcttttcaatgacatgctc
caatgcaccatgcaacgttga

DBGET integrated database retrieval system