KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_03650Help
Entry
I653_03650        CDS       T02520                                 

Definition
putative cytochrome
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:bsy00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:bsy00380]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:bsy00627]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
762009..765194
Genome map
AA seq 1061 aa AA seqDB search
MKETSPIPQPKTFGPLGNLPLIDKDKPTLSLIKLAEEQGPIFQIHTPAGTTIVVSGHELV
KEVCDEERFDKSIEGALEKVRAFSGDGLFTSWTHEPNWRKAHNILMPTFSQRAMKDYHEK
MVDIAVQLIQKWARLNPNEAVDVPGDMTRLTLDTIGLCGFNYRFNSYYRETPHPFINSMV
RALDEAMHQMQRLDVQDKLMVRTKRQFRHDIQTMFSLVDSIIAERRSNGDQDEKDLLARM
LNVEDPETGEKLDDENIRFQIITFLIAGHETTSGLLSFATYFLLKHPDKLKKAYEEVDRV
LTDAAPTYKQVLELTYIRMILNESLRLWPTAPAFSLYPKEDTVIGGKFPITTKDRISVLI
PQLHRDRDAWGKDAEEFRPERFEHQDQVPHHAHKPFGNGQRACIGMQFALHEATLVLGMI
LKYFTLIDHENYELDIKQTLTLKPGDFHIRVQSRNQEAIHADVQAAEKAVSDEQKEKTEA
KGASVIGLNNRPLLLLYGSDTGTAEGVARELADTASLHGVRTETAPLNDRIGKLPKEGAV
VIVTSSYNGKPPSNAGQFVQWLQEIKPGELEGVHYAVFGCGDHNWASTYQYVPRFIDEQL
AEKGATRFSARGEGDVSGDFEGQLDEWKKSMWADAIKAFGLELNENADKERSTLSLQFVR
GLGESPLARSYEASHASIAENRELQSADSDRSTRHIEIALPPDVEYQEGDHLGVLPKNSQ
TNVSRILHRFGLKGTDQVTLSASGRSAGHLPLGRPVSLHDLLSYSVEVQEAATRAQIREL
AAFTVCPPHRRELEELSAEGVYQEQILKKRISMLDLLEKYEACDMPFERFLELLRPLKPR
YYSISSSPRVNPRQASITVGVVRGPAWSGRGEYRGVASNDLAERKAGDDVVMFIRTPESR
FQLPEDPETPIIMVGPGTGVAPFRGFLQAREVLKREGKTLGEAHLYFGCRNDRDFIYRDE
LEQFEKDGIVTVHTAFSRKEGMPKTYVQHLMADHAETLISILDRGGRLYVCGDGSKMAPD
VEAALQKAYQSVHGTGEQEVQNWLRHLQDTGMYAKDVWAGI
NT seq 3186 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaaacaagcccgattcctcagccgaagacgtttgggccgctaggcaatttgcct
ttaatcgataaagacaagccgacgctttcgctgatcaaactggcggaagaacagggcccg
atttttcaaatccatacacccgcgggcacgaccattgtagtgtccggccacgaattggtg
aaagaggtttgtgatgaagaacggtttgataaaagcattgaaggcgccttggaaaaggtt
cgcgcattttccggtgacggattgtttacgagctggacgcatgagcctaactggagaaaa
gcgcacaacattctgatgccgacgttcagccagcgggccatgaaggactatcatgagaaa
atggtcgatatcgctgttcagctcattcaaaaatgggccaggctcaatccgaatgaagca
gtcgatgtcccgggagatatgacccggctgacgctcgacaccattgggctatgcgggttt
aactaccgctttaacagttactacagagaaacgccccacccgtttatcaacagcatggtg
cgggcgcttgatgaagcgatgcatcaaatgcagcggcttgatgttcaagataagcttatg
gtcagaacaaagcggcaattccgccatgatattcaaacgatgttttcgttagtcgacagc
attattgcagagcgccgatcgaatggagaccaggatgaaaaagatttgctcgcccgcatg
ctgaatgtggaagatccggaaacgggtgaaaagctcgacgacgaaaatatccgctttcag
atcattacgtttttgattgccggccatgaaacaacgagcggcctgctctcctttgcgacc
tactttttattgaagcatcctgacaaactgaaaaaggcgtatgaagaggtcgatcgggtg
ctgacggatgcagcgccgacctataaacaagtgctggagcttacatacatacggatgatt
ttaaatgaatcactgcgcttatggccgacagctccggctttcagcctttatccaaaagaa
gacacagtcattggcggaaaattcccgatcacgacgaaagacagaatttctgtgctgatt
ccgcagcttcatcgtgatcgagacgcttggggaaaggacgcagaagaattccggccggaa
cggttcgagcatcaggaccaagtgcctcaccatgcgcacaaaccattcggaaatggccaa
cgggcctgtatcggcatgcagtttgcccttcatgaagccacacttgtgctgggcatgatt
ctaaaatatttcacactgattgatcatgagaattatgagcttgatatcaaacaaacctta
acacttaagccgggcgattttcacatcagggttcaaagccgtaatcaggaagccattcat
gcggacgtccaggcagctgaaaaagccgtgtctgatgagcaaaaggagaaaacggaagca
aagggcgcatcggtcatcggtcttaacaaccgcccgcttctcttactgtacggctctgat
accggcactgcagaaggcgtcgcccgggagcttgctgatactgccagtcttcacggcgta
aggacagagacagcacctctgaacgaccgaattggaaagctgccgaaagagggagcggtt
gtcattgtgacctcgtcttataatggaaaaccgccaagcaatgccggacagttcgtgcag
tggcttcaagaaatcaaaccgggtgagcttgagggcgttcattacgcggtatttggctgc
ggcgaccacaactgggcgagcacgtatcaatacgtgccgagattcattgatgagcagctt
gcggaaaaaggcgcgactcggttttctgcgcgcggagaaggtgatgtcagcggtgatttt
gaagggcagcttgacgagtggaaaaaaagcatgtgggcggacgccattaaggcattcgga
cttgagcttaatgaaaacgctgataaggagcgaagcacgctgagccttcagtttgtcaga
gggctgggcgagtctccgctggctagatcatacgaagcctctcacgcatccattgccgaa
aatcgtgaactccagtctgcagacagcgatcgaagcactcgccatatcgaaattgcattg
ccgccggatgttgaatatcaagagggcgaccatcttggcgtattgccaaaaaacagccaa
accaatgtcagccggattctccacagattcggtctgaagggaaccgaccaagtgacattg
tcggcaagcggccgcagtgcggggcatctgccattgggccgtcctgtcagcctgcatgat
cttctcagctacagcgtcgaggtgcaggaagcagccacaagagcgcaaatacgtgaactg
gcggcatttacagtgtgtccgccgcataggcgtgaattagaagaactgtcagcagagggt
gtttatcaggagcaaatattgaaaaaacgaatttccatgctggatctgcttgaaaagtat
gaagcgtgtgacatgccgtttgaacgatttttagagcttttacgtccgttaaaaccgaga
tattattcaatttcaagctctccaagagtgaatccgcggcaagcatcgatcacagtcggt
gtcgtgcgcggccctgcgtggagcggccgtggcgaatacaggggcgtggcttcaaatgat
ttagctgagcgtaaagccggtgatgatgtcgtgatgtttatccgcacaccggaatcccgg
tttcagcttccagaagaccctgaaactccaatcattatggtcggaccaggcacaggagta
gcgccattccgcggtttccttcaagcccgtgaagttttaaagcgggaggggaaaacgctc
ggtgaagctcatctctattttggatgcaggaacgatcgtgattttatataccgcgatgag
cttgagcagtttgaaaaagacggaatcgtcactgtccacacagccttttcccgcaaagaa
ggcatgccgaaaacgtatgtccagcatctaatggctgaccatgcagaaacattaatatcg
atccttgaccgcggaggcaggctttatgtatgcggtgatggcagcaaaatggccccggat
gtggaggcggcactgcaaaaggcgtatcagtctgttcatggcaccggggagcaagaagtg
caaaactggctgagacatctgcaggataccggtatgtacgctaaggatgtctgggcaggg
atatag

DBGET integrated database retrieval system