KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_04740Help
Entry
I653_04740        CDS       T02520                                 

Definition
alkaline phosphatase A
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bsy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    I653_04740
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    I653_04740
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    I653_04740
Enzymes [BR:bsy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     I653_04740
Exosome [BR:bsy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   I653_04740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(981930..983306)
Genome map
AA seq 458 aa AA seqDB search
MNLFQKMKSKFLPIAAVSVLTAGIFAGAELQQTEKASAKKQDKAEIRNVIVMIGDGMGTP
YIRAYRSMKNNGDTPNNPKLTEFDRNLTGMMMTHPDDPDYNITDSAAAGTALATGVKTYN
NAIGVDKNGKKVKSVLEEAKQQGKSTGLVVTSEINHATPAAYGAHNESRKNMDQIANSYM
DDKIKGKHKIDVLLGGGKSYFNRKDRNLTKEFKQAGYSYVTTKQALKKNKDQQVLGLFAD
GGLAKALDRDSKTPSLKEMTVSAIDRLNQNKKGFFLMVEGSQIDWAAHDNDTVGAMSEVK
DFEQAYKAAIEFAKKDKHTLVIAAADHTTGGFTIGANGEKNWHAEPILSAKKTPEFMAKK
ISKGKPVKDVLARYANLKFTSEEIKSVEAAAQADKSKGAYKAIIKIFNTRSNSGWTSTDH
TGEEVPVYAYGPGKEKFRGLINNTDQANIIFKILKTGK
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgtttcaaaaaatgaaatcaaaatttctgccaatcgccgctgtttctgtcctt
acagctggaatttttgccggagctgagctgcagcaaacagaaaaggccagcgccaaaaaa
caagacaaagctgagatcagaaatgtcattgtgatgataggcgacggcatggggacgcct
tacataagagcctaccgttccatgaaaaataacggtgacacaccgaataacccgaagtta
acagaatttgaccggaacctgacaggcatgatgatgacgcatccggatgaccctgactat
aatattacagattcagcagcagccggaacagcattagcaacaggcgttaagacatataac
aatgcaattggcgtcgataaaaacggaaaaaaagtgaaatctgtacttgaagaggccaaa
cagcaaggcaagtcaacagggcttgtcgtcacgtctgaaattaaccacgccactccagcc
gcatatggcgcccacaatgaatcacggaaaaatatggaccaaatcgccaacagctatatg
gatgacaaaataaaaggcaaacataaaatagacgtgctgctcggcggcggaaaatcttat
tttaaccgcaaggacagaaacttgacaaaggaattcaaacaagccggctacagctatgtg
acaacgaaacaagcattgaaaaaaaataaagatcagcaggtgctcgggcttttcgcagat
ggagggcttgctaaagcgctcgaccgtgacagtaaaacaccgtctctcaaagaaatgacg
gtttcagcaattgatcgcctgaaccaaaataaaaaaggatttttcttgatggtcgaaggg
agccagattgactgggcggcccatgacaatgataccgtaggagccatgagcgaggttaaa
gattttgaacaggcctataaagccgcgattgaatttgcgaaaaaagacaaacatacactt
gtgattgcagctgctgaccatacaaccggcggctttaccattggcgcgaacggggaaaag
aattggcacgcagaaccgattctctccgctaagaaaacacctgaattcatggccaaaaaa
atcagtaaaggcaagccggttaaagatgtgctcgcccgctatgccaatctgaaattcaca
tctgaagaaatcaaaagcgttgaagcagctgcacaggctgacaaaagcaaaggggcctac
aaagctatcatcaagatttttaatacccgctccaacagcggatggacgagtaccgatcat
accggcgaagaagtaccggtatacgcgtacggccccggaaaagaaaaattccgcggattg
attaacaatacggaccaggcaaacatcatatttaagattttaaaaactggaaaataa

DBGET integrated database retrieval system