KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_09410Help
Entry
I653_09410        CDS       T02520                                 

Definition
cellulase C
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsy00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    I653_09410
Enzymes [BR:bsy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     I653_09410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1907908..1909407
Genome map
AA seq 499 aa AA seqDB search
MKRSISIFITCLLITLLTMGGMMASPASAAGTKTPVAKNGQLSIKGTQLVNRDGKAVQLK
GISSHGLQWYGEYVNKDSLKWLRDDWGITVFRAAMYTADGGYIDNPSVKNKVKEAVEAAK
ELGIYVIIDWHILNDGNPNQNKEKAKEFFKEMSSLYGNTPNVIYEIANEPNGDVNWKRDI
KPYAEEVISVIRKNDPDNIIIVGTGTWSQDVNDAADDQLKDANVMYALHFYAGTHGQFLR
DKANYALSKGAPIFVTEWGTSDASGNGGVFLDQSREWLKYLDSKTISWVNWNLSDKQESS
SALKPGASKTGGWRLSDLSASGTFVRENILGTKDSTRDIPETPAKDKPTQENGISVQYRA
GDGSMNSNQIRPQLQIKNNGNTTVDLKDVNARYWYKAKNKGQNVDCDYAQIGCGNVTYKF
VTLHKPKQGADTYLELGFKNGTLAPGASTGNIQLRLHNDDWSNYAQSGDYSFFKSNTFKT
TKKITLYDQGKLIWGTEPN
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggtcaatctctatttttattacgtgtttattgattacgttattgacaatgggc
ggcatgatggcttcgccggcatcagcagcagggacaaaaacgccagtagccaagaatggc
cagcttagcataaaaggtacacagctcgttaaccgagacggtaaagcggtacagctgaag
gggatcagttcacacggattgcaatggtatggagaatatgtcaataaagacagcttaaaa
tggctgagggacgattggggtatcaccgttttccgtgcagcgatgtatacggcagatggc
ggttatattgacaacccgtccgtgaaaaataaagtaaaagaagcggttgaagcggcaaaa
gagcttgggatatatgtcatcattgactggcatattttaaatgacggtaatccaaaccaa
aataaagagaaggcaaaagaattcttcaaggaaatgtcaagtctttacggaaacacgcca
aacgtcatttatgaaattgcaaacgaaccaaacggtgatgtgaactggaagcgtgatatt
aaaccgtatgcggaagaagtgatttccgttatccgcaaaaatgatccagacaacatcatc
attgtcggaaccggtacatggagccaggatgtgaatgatgctgccgatgaccagctaaaa
gatgcaaacgttatgtacgcacttcatttttatgccggcacacacggccaatttttacgg
gataaagcaaactatgcactcagcaaaggagcacctatttttgtgacagaatggggaaca
agcgacgcgtctggaaatggcggtgtattccttgatcaatcgagggaatggctgaaatat
ctcgacagcaagaccattagctgggtgaactggaatctttctgataagcaggaatcatcc
tcagctttaaagccgggggcatctaaaacaggcggctggcggttgtcagatttatctgct
tcaggaacattcgttagagaaaacattctcggcaccaaagattctacgagggacattcct
gaaacgccagcaaaagataaacccacacaggaaaatggtatttctgtacaatacagagct
ggggatgggagtatgaacagcaaccaaatccgtccgcagcttcaaataaaaaataacggc
aataccacggttgatttaaaagatgtcaatgcccgttactggtataaagcgaaaaacaaa
ggccaaaacgttgactgtgactacgcgcagattggatgcggcaatgtgacatacaagttt
gtgacgttgcataaaccaaagcaaggtgcagatacctatctggaacttggatttaaaaac
ggaacgttggcaccgggagcaagcacagggaatattcagcttcgtcttcacaatgatgac
tggagcaattatgcacaaagcggcgattattcctttttcaaatcaaatacgtttaaaaca
acgaaaaaaatcacattatatgatcaaggaaaactgatttggggaacggaaccaaattag

DBGET integrated database retrieval system