KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_12890Help
Entry
I653_12890        CDS       T02520                                 

Definition
cytochrome
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsy00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    I653_12890
  Amino acid metabolism
   00380 Tryptophan metabolism
    I653_12890
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    I653_12890
Enzymes [BR:bsy01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     I653_12890
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     I653_12890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2548509..2551673)
Genome map
AA seq 1054 aa AA seqDB search
MKQASAIPQPKTYGPLKNLPHLEKEQLSQSLWRIADELGPIFRFDFPGVSSVFVSGHNLV
AEVCDESRFDKNLGKGLQKVREFGGDGLFTSWTHEPNWQKAHRILLPSFSQKAMKGYHSM
MLDIATQLIQKWSRLNPNEEIDVADDMTRLTLDTIGLCGFNYRFNSFYRDSQHPFITSML
RALKEAMNQSKRLGLQDKMMVKTKLQFQKDIEVMNSLVDRMIAERKANPDEDIKDLLSLM
LYAKDPVTGETLDDENIRYQIITFLIAGHETTSGLLSFAIYCLLTHPEKLKKAQEEADRV
LTDDTPEYKQIQQLKYIRMVLNETLRLYPTAPAFSLYAKEDTVLGGEYPISKGQPVTVLI
PKLHRDQNAWGPDAEDFRPERFEDPSSIPHHAYKPFGNGQRACIGMQFALQEATMVLGLV
LKHFELINHTGYELKIKEALTIKPDDFKITVKPRKTAAINVQRKEQADIKAETKPKETKP
IHGTPLLVLYGSNLGTAEGIAGELAAQGRQMGFAAETAPLDDYIGKLPEEGAVVIVTASY
NGAPPDNAAGFVEWLKELKEGQLKGVSYAVFGCGNRSWASTYQRIPRLIDDMMKAKGASR
LTEIGEGDAADDFESHRESWENRFWKETMDAFDINEIAQKEDRPSLSITFLSETTETPVA
KAYGAFEGVVLENRELQTADSTRSTRHIELEIPAGKTYKEGDHIGIMPKNSRELVQRVLS
RFGLQSNHVIKVSGSAHMAHLPMDRPIKVVDLLSSYVELQEPASRLQLRELASYTVCPPH
QKELEQLVSDDGIYKEQVLAKRLTMLDFLEDYPACEMPFERFLALLPSLKPRYYSISSSP
KVHANIVSMTVGVVKASAWSGRGEYRGVASNYLAELNTGDAAACFIRTPQSGFQMPDESE
TPMIMVGPGTGIAPFRGFIQARSVLKKEGSTLGEALLYFGCRRPDHDDLYREELDQAEQD
GLVTIRRCYSRVENEPKEYVQHLLKQDTQKLMTLIEKGAHIYVCGDGSQMAPDVEKTLRL
AYEAEKGASQEESAEWLQKLQDQKRYVKDVWTGM
NT seq 3165 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaggcaagcgcaatacctcagcccaaaacatacggacctttaaaaaatcttccg
catctggaaaaagaacagctttctcaatccttatggcggatagctgatgaattgggaccg
attttccgttttgattttccgggagtatccagtgtttttgtctcgggccacaatcttgtg
gctgaagtatgtgatgaaagccgcttcgacaagaaccttggcaaaggcttgcaaaaggtg
cgcgagttcgggggagatggcttatttacaagctggacgcacgaaccgaactggcaaaaa
gcccaccgcattttgctgccgagttttagtcaaaaagcgatgaaaggctatcattctatg
atgctggatatcgcaacccagctgattcaaaagtggagccgcttaaaccctaatgaagaa
attgatgtagcggacgatatgacacgtctgacgcttgatacgattgggttatgcgggttt
aactatcgattcaacagcttttaccgtgattcacagcatccgtttatcaccagtatgctc
cgtgccttaaaagaggcgatgaatcaatcgaaaagactgggcctgcaagataaaatgatg
gtgaaaacgaagctgcagttccaaaaggatatagaagtcatgaactccctggttgataga
atgatagcggagcgaaaggcgaatccggatgaagacattaaggatctcttgtctctcatg
ctttatgccaaagatccagtaacgggtgaaacgctggatgacgaaaacattcgataccaa
atcatcacatttttaattgctggacatgagacaacaagcgggttgctttcctttgcgatt
tattgtctgcttacacatccggaaaaactgaaaaaagctcaggaggaagcggatcgcgtg
ttaacagatgacacgcctgaatataaacaaatccagcagctcaaatacattcggatggtt
ttaaatgaaaccctcagactgtatccaacagctccggctttttctctatatgcgaaggag
gatactgttctaggcggggaatatccgatcagtaaagggcagccagtcactgttttaatt
ccaaaactgcaccgggatcaaaacgcttggggaccggatgcggaagatttccgtccggaa
cggtttgaggatccttcaagtatccctcaccatgcgtataagccgtttggaaacggacag
cgcgcttgtattggcatgcagtttgctcttcaagaagcgacaatggttctcggtcttgta
ttaaagcattttgaattgataaaccatactggctatgaactaaaaatcaaagaagcatta
acgatcaagccggatgattttaaaattactgtgaaaccgcggaaaacagcggcaatcaat
gtacagagaaaagaacaggcagacatcaaagcagaaacaaagccaaaagaaaccaaacct
atacacggcacacctttactcgttctttacggttcaaaccttgggacagctgagggaata
gccggtgaactggctgctcaaggccgccagatgggctttgcagctgaaacggctccgctt
gatgattatatcggcaagctccctgaagaaggggcagtcgtcattgtaacggcttcttat
aatggggcgccgcctgataatgctgccggctttgtagagtggctgaaagagcttaaggaa
ggccaattgaaaggtgtttcctatgcggtattcggctgcgggaaccggagctgggccagc
acgtatcagcggattccccgcctgattgatgacatgatgaaagcaaagggggcatcgcgt
ttaacagagattggggaaggtgacgccgccgatgattttgaaagccatcgcgagtcttgg
gaaaaccgcttctggaaggaaacgatggacgcatttgatattaacgaaatagcccagaaa
gaagacaggccttcattatcgattacttttctcagtgagacgacggaaacgccggttgct
aaagcatatggcgcgtttgaaggggtagtgttagagaatcgagaactccagacagctgac
agcacgcgttcaacccgccatattgaattggaaattccggctggtaaaacatataaagaa
ggcgatcatatcggaatcatgccgaagaacagcagggagcttgttcagcgggttctcagc
cgattcggtttgcagtccaatcatgtgataaaagtaagcggaagcgctcatatggctcat
ctgccgatggatcggccgataaaagtagtggatttattgtcgtcctatgtagagctgcag
gaaccggcatcaaggcttcagcttcgggagctggcctcttatacagtttgtccgccgcat
caaaaagagctggaacagctcgtttcagatgatggcatttacaaagagcaggtacttgca
aaacgtcttaccatgcttgattttttagaggattatcctgcttgcgaaatgccgtttgaa
cggtttttagcacttttgccatcactaaaaccgagatactattccatttcaagctcaccg
aaagttcatgcaaatatcgtgagcatgacggtaggagttgtgaaagcctcagcatggagc
ggccgaggtgaataccggggtgtcgcctctaattatttagcagaattgaatacaggtgat
gcagcagcctgtttcattcgtactccgcagtccggattccaaatgccggatgagtctgaa
acgcctatgattatggtcgggccgggcacaggaattgcgccattcaggggctttattcag
gcaagatcggttttgaagaaggaaggaagcacccttggtgaagcacttttatacttcggc
tgccgccgcccggaccatgacgacctttacagagaagagctggatcaagcggaacaggac
ggtttggtcacaatccgccgatgctactcgcgcgtcgaaaacgaaccaaaagaatatgtc
cagcacttgctcaagcaagatacgcagaaattgatgacactcattgaaaaaggggctcat
atttacgtatgcggtgatggatcgcaaatggctcctgatgtagagaaaactttgcgattg
gcgtatgaagctgaaaaaggagcaagtcaggaagaatcagctgaatggctgcaaaagctg
caagatcaaaaacgttatgtaaaagacgtttggacaggaatgtaa

DBGET integrated database retrieval system