KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_13765Help
Entry
I653_13765        CDS       T02520                                 

Definition
endo-1,4-beta-glucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsy00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    I653_13765
Enzymes [BR:bsy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     I653_13765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2725155..2726240)
Genome map
AA seq 361 aa AA seqDB search
MAKLDETLTMLKDLTDAKGIPGNEREVRQVMKSYIEPFADEVTTDRLGSLIAKKTGAENG
PKIMIAGHLDEVGFMVTQITDKGFIRFQTVGGWWAQVMLAQRVTIVTKKGEITGVIGSKP
PHILSPEARKKSVEIKDMFIDIGASSREEALEWGVLPGDMIVPHFEFTVMNNEKFLLAKA
WDNRIGCAIAIDVLRNLQNTDHPNIVYGVGTVQEEVGLRGAKTAAHTIQPDIAFGVDVGI
AGDTPGISEKEAQSKMGKGPQIIVYDASMVSHKGLRDAVVATAEEAGIPYQFDAIAGGGT
DSGAIHLTANGVPALSITIATRYIHTHAAMLHRDDYENAVKLITEVIKKLDRKTVDEITY
R
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaattagatgaaacattgaccatgctgaaagatttaacagatgcaaaaggcata
ccgggcaatgaaagagaagtaaggcaagtgatgaaatcatacatagaaccatttgctgat
gaggtgacaacagatcgcctgggcagtttaattgccaaaaaaactggtgcagaaaacggc
ccgaaaattatgatcgccggacatttggatgaagtcggctttatggtgacacaaatcaca
gataaaggctttatccgttttcaaaccgttggcggctggtgggctcaggttatgcttgcc
cagcgcgtcaccattgtcacaaaaaaaggagaaatcacaggggttatcggatctaagccg
cctcatattttgtctcctgaagcaagaaaaaaatcagtggaaataaaagacatgtttatt
gatatcggagcttcaagccgggaagaagccttggagtggggtgtacttccgggagatatg
atcgttccgcattttgaatttacggtcatgaacaatgaaaaattcctactcgcaaaggcc
tgggacaaccgcatcggctgtgcgattgcaattgatgtgttaagaaacttacaaaacaca
gaccatccaaatatagtgtatggcgtcggaaccgtgcaggaggaagtcggcctgagggga
gcgaaaacggctgcacacaccattcagcctgatattgcgtttggtgttgatgtagggata
gcaggagacacgcctggcatttccgagaaggaagcgcagagcaaaatgggcaaaggcccg
cagattatcgtttacgatgcatccatggtctctcacaaaggtttgcgcgatgcagttgta
gccactgcggaggaagccggcattccgtaccaatttgatgccattgccggcggcggaact
gattcgggtgccatccatttgacggcaaatggcgttcctgcgctgtccattactattgca
acccgctacattcatacgcacgcggccatgctgcatcgtgatgattatgaaaacgcggta
aagttaattacagaagtcattaagaagttagaccgaaaaacggttgacgaaattacgtac
cgataa

DBGET integrated database retrieval system