KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_16285Help
Entry
I653_16285        CDS       T02520                                 

Definition
carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3230910..3231650)
Genome map
AA seq 246 aa AA seqDB search
MKVVTPKPFTFKGGDKAVLLLHGFTGNTADVRMLGRYLNERGYTCHAPQYEGHGVPPEEL
VHTGPEDWWKNVMDGYEYLKSEGYESIAACGLSLGGVFSLKLGYTVPIKGIVPMCAPMHI
KSEEVMYQGVLSYARNYKKFEGKSPEQIEEEMKEFEKTPMNTLKALQDLIADVRNNVDMI
YSPTFVVQARHDHMINTESANIIYNEVETDDKQLKWYEESGHVITLDKERDLVHQDVYEF
LEKLDW
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttgtgacaccaaaaccatttacatttaaaggcggagacaaagcggtgcttttg
ctgcatggctttacaggaaatacagcggatgtaaggatgctgggacgatatttgaatgaa
cgcggctatacgtgccacgcgcctcaatatgaaggacatggcgtcccgcctgaagaactt
gtacatacggggcccgaagactggtggaaaaacgtaatggatggctatgaatacttaaaa
tctgaaggctatgagagcattgctgcctgcggactgtcgcttggcggggttttttcgctg
aaattgggttacactgtacccataaagggaattgtcccaatgtgcgcaccgatgcatatt
aagagtgaagaggtcatgtatcaaggcgttctttcatacgctcgcaattacaaaaagttt
gaggggaaaagccctgagcaaattgaagaggaaatgaaagaattcgaaaaaacgccgatg
aataccctcaaggcgctgcaagacttaattgctgatgtgcggaataatgtcgatatgatt
tattcaccgacatttgtggtgcaggcccgtcatgaccacatgattaataccgaaagcgcc
aatattatttacaacgaagtggaaactgatgataaacagctgaaatggtacgaggaatca
gggcatgtcattacactcgacaaagaacgtgacctcgtccatcaggatgtgtatgaattt
ttagagaagctcgattggtaa

DBGET integrated database retrieval system