KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_18550Help
Entry
I653_18550        CDS       T02520                                 

Definition
spore coat polysaccharide biosynthesis protein
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsy00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    I653_18550
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    I653_18550
Enzymes [BR:bsy01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     I653_18550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3689081..3689536)
Genome map
AA seq 151 aa AA seqDB search
MIDGVKVKKLTKHSDDRGFFAELVRDDENLLEHFGQASWSKSYPGVIKAFHYHEKQDDLW
FFPTGHAQVVLYDLREDSKTKGETDVYYMGEDNPMLLLIPKGVAHGYRVLGETPLTIIYF
TTMSYNPDQPDEKRIPWNDETIGFNWNTEFR
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
gtgattgatggagtcaaggtgaaaaaattgacgaagcatagcgatgacagaggctttttt
gctgagctggtccgggacgatgagaatctccttgagcattttgggcaggcttcttggtcg
aaaagctatccgggtgtgattaaggcatttcattatcatgagaagcaggatgatctctgg
ttcttcccaaccggccacgctcaggttgtcctatacgatcttcgagaggattcaaagaca
aaaggagaaacggacgtctattatatgggcgaagacaacccgatgctgttattaatccca
aaaggggtggctcacggatatagagtgctgggagagacgccgctgacaattatctatttt
accaccatgtcgtataacccggatcagcctgatgaaaaaagaattccgtggaatgatgag
acgatcggttttaactggaacactgaattcagataa

DBGET integrated database retrieval system