KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_19590Help
Entry
I653_19590        CDS       T02520                                 

Definition
aldehyde dehydrogenase
Orthology
K00128  
aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Pathway
Glycolysis / Gluconeogenesis
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Arginine and proline metabolism
Histidine metabolism
Tryptophan metabolism
beta-Alanine metabolism
Glycerolipid metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:bsy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    I653_19590
   00040 Pentose and glucuronate interconversions
    I653_19590
   00053 Ascorbate and aldarate metabolism
    I653_19590
   00620 Pyruvate metabolism
    I653_19590
   00640 Propanoate metabolism
    I653_19590
  Lipid metabolism
   00071 Fatty acid degradation
    I653_19590
   00561 Glycerolipid metabolism
    I653_19590
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    I653_19590
   00310 Lysine degradation
    I653_19590
   00330 Arginine and proline metabolism
    I653_19590
   00340 Histidine metabolism
    I653_19590
   00380 Tryptophan metabolism
    I653_19590
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    I653_19590
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    I653_19590
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    I653_19590
Enzymes [BR:bsy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     I653_19590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3903666..3905003
Genome map
AA seq 445 aa AA seqDB search
MEQQVKDDIQRVFQLQKKQQKALRASTAEQRREKLQRFLDSVIAHEEEIIEAIRKDVRKP
YHEVKKAEIEGTKKAIRDNMNNLEQWMAPKEVGSSLSPDANGILMYEPKGVTLILGPWNY
PFMLTMAPLAASLAAGNSAIVKLSDFTMNTSNIAAKVIRDAFDDKEVAIFEGEVEVATEL
LDQPFDHIFFTGSTNVGKIVMTAAAKHLASVTLELGGKSPTIIDSDYDLMDAAKKIAVGK
FVNAGQTCIAPDYLFIKKDVQDRFAGILQTIVNAGFMEDDHTPDRSKFTQIVNDRNFNRV
KDLFDDAIKKGAEVVFGGVFDASDRTISPTVLKNVTPDMKIMQEEIFAPILPMMNYEDID
EVIDYVNDHDKPLALYVFSQNQDLIDNVLQHTTSGNAAINDVVVHFSDVNLPFGGVNTSG
IGSYHGVYGFKEFSHEKGVFIQASK
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggaacagcaagtaaaggacgacatccagcgtgtctttcagcttcagaaaaaacagcaa
aaagccttgcgcgcttcaacagcggaacagcggagagaaaagcttcaacgctttttagat
tccgtcatcgcccatgaagaagaaatcatcgaagcgatccgcaaagacgtccgcaaacca
tatcacgaggtcaaaaaagcggaaatcgaaggaacaaaaaaagcgatcagagataatatg
aataacctggaacaatggatggcgcctaaagaagtcggttcatcgttaagccctgacgca
aacggaattcttatgtacgagcctaaaggcgtcacactcatcctcggcccgtggaactat
ccgtttatgctgacgatggcgccgcttgccgcttctctcgcagccggaaacagcgcgatt
gtgaagctgtccgatttcacgatgaacacgagcaacattgccgctaaagtgataagagac
gcttttgatgacaaagaagtcgcgatttttgaaggagaggttgaggtggcaaccgagctt
cttgatcagccgttcgaccacattttcttcactggaagcacaaatgtcgggaaaatcgtc
atgacagcggctgccaaacacttggcatctgtcacacttgagcttggcggcaagagccca
acgattatcgacagcgattacgatctgatggacgcagcgaaaaagatcgccgtcgggaaa
ttcgtaaacgctggccaaacctgcatcgcacctgattacctgttcattaaaaaagacgtt
caggacaggttcgcggggattttacaaacaatcgttaacgcaggatttatggaggatgat
cataccccagaccgcagcaaatttacgcagatcgtcaatgaccgcaacttcaaccgcgtc
aaagatctgttcgacgatgccatcaaaaaaggggcggaagtggtgttcggcggcgtattt
gatgccagcgaccgcacgatctcgccaaccgttttgaaaaacgtcacgcctgatatgaaa
atcatgcaggaggaaatcttcgcaccaatcctgccgatgatgaattatgaagacatcgac
gaggtcatcgattacgtaaatgatcacgataaaccgcttgcgctttatgtattcagccaa
aaccaagacctgattgacaacgtccttcagcacacgacatcaggaaatgccgccatcaat
gatgtcgtcgtccatttcagtgacgtcaacctgccattcggcggcgtcaacacaagcgga
atcggctcctatcatggggtatacggattcaaagagttttctcatgagaagggtgtcttt
attcaggcctctaaataa

DBGET integrated database retrieval system