KEGG   Bos taurus (cow): 100124510Help
Entry
100124510         CDS       T01008                                 

Gene name
BAP1, BAIAP3
Definition
BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) (EC:3.4.19.12)
Orthology
K08588  
ubiquitin carboxyl-terminal hydrolase BAP1 [EC:3.4.19.12]
Organism
bta  Bos taurus (cow)
Brite
Enzymes [BR:bta01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100124510 (BAP1)
Peptidases [BR:bta01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   100124510 (BAP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
22
AA seq 711 aa AA seqDB search
MNKGWLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCQGPVYGFIFLFKWIEERRSRR
KVSTLVDDTSVIDDDIVNNMFFAHQLIPNSCATHALLSVLLNCSNVDLGPTLSRMKDFTK
GFSPESKGYAIGNAPELAKAHNSHARPEPRHLPEKQNGLSAVRTMEAFHFVSYVPITGRL
FELDGLKVYPIDHGPWGEDEEWTDKARRVIMERIGLATAGIKYEARLHVLKVNRQTVLEA
LQQLIRVTQPELIQTHKSQESQLPEESKPASSKSPLALETSRAPVASESTHTDGVEEVAG
SCPQAPTHSPPSKPKLVVKPPGSNINGVPPNPTPIVQRLPAFLDNHNYAKSPMQEEEDLA
AGVGRSRVPVRPPQQYSDDEDDYEDEEEDDAQSTSSAIRYKRKGPGKPGPLSSSGDGQLS
VLQPNTINVLAEKLKESQKDLSIPLSIKTSSGAGSPAVAVPTHSQPSPTPSNESTDTASE
IGSAFNSPLRSPIRSANPTRPSSPVTSHISKVLFGEDDSLLRVDCIRYNRAVRDLGPVIS
TGLLHLAEDGVLSPLALTESGKGSSPSIRPSQGSQGSGSPEEKEVVEAVDSREKPGLVRP
SESLNGEKYSPKELLALLKCVEAEIANYEACLKEEVEKRKKFKIDDQRRTHNYDEFICTF
ISMLAQEGMLANLVEQNISVRRRQGVSIGRLHKQRKPDRRKRSRPYKAKRQ
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atgaataagggctggctggagctggagagcgaccctggcctcttcaccctcctcgtggaa
gatttcggtgtcaaaggggtgcaggtggaggagatctatgaccttcagagcaaatgccaa
ggccccgtgtatggattcatcttcctgttcaaatggatcgaagagcgccgatcccgtcgc
aaggtctctaccttggtggatgatacatctgtgattgatgatgatattgtgaataacatg
ttctttgcccaccagctgatccccaactcttgtgccacccatgccctgctgagcgtgctc
ctgaactgcagcaatgtggacctggggcccaccctgagtcgcatgaaggacttcaccaaa
ggcttcagccctgagagcaaaggatatgcgattggcaatgctccggagttggccaaggca
cataatagccatgccaggcctgagccacgccacctccctgagaagcagaatggccttagt
gctgtgcggaccatggaagccttccactttgtcagctatgtgcctatcacaggccggctt
tttgagctggatgggctgaaagtctaccccattgaccatgggccctggggggaggatgag
gagtggacggacaaagcccggcgggtcatcatggagcgtattggcctcgccactgcaggg
atcaagtacgaggccaggctacacgtgttgaaggtgaaccgtcagaccgtactggaggcc
ctgcagcagctgatcagggtaacacagccagagctgattcagacccacaagtctcaagag
tcacagctgcctgaagaatccaaacccgccagcagcaagtcccctctggcgctggaaaca
agcagggccccggtggcctctgagagcacccacacagatggcgtggaagaggtggctggt
tcatgcccacaagccccgactcacagccctcctagcaaacccaagctggtggtgaagcct
ccagggagcaacatcaatggggttccccccaaccccactcctattgtccagcggctgcca
gcctttctggacaatcacaactatgccaagtcccccatgcaggaggaggaagacctggca
gcgggtgtgggccgcagcagagttccagtgcgcccgccccagcagtactcagacgatgaa
gatgactacgaggatgaggaggaggacgacgcacagagcaccagctccgccatcaggtat
aagcgaaaggggccggggaaaccagggccattgagcagctctggagatgggcagctgtca
gtgctacagcccaacaccatcaacgtcttggccgagaagctcaaagagtcccagaaggac
ctctcgattcctctgtccatcaagacgagcagcggggcggggagtccggctgtggcagtg
cccacgcactcgcagccctcgcccacccccagcaacgagagcacggacacagcctctgag
atcggcagcgctttcaattcgccactgcgctcgcccatccgctcagccaaccccacgcgg
ccctctagtcccgtcacctcgcacatctccaaggtgctttttggagaggacgacagcctg
ctgcgtgttgactgcatacgctacaatcgtgctgtacgcgacctgggtcctgtcatcagc
acgggcctcctgcacctggctgaggatggtgtgctgagtcccctggcactgacagagagt
gggaagggttcctccccttccatcagaccaagccaaggcagccaggggtctggcagccca
gaggagaaggaggtggtggaggctgtggacagcagagagaagccagggctggtcaggcct
agcgagtccttgaatggggagaagtattcacccaaggagctgctggcgctgctgaagtgt
gtggaggctgaaattgcaaactatgaggcctgtctcaaggaagaagtggagaagaggaag
aagttcaagattgacgaccagagaaggacccacaactacgatgagttcatctgcaccttc
atctccatgctggctcaggaaggcatgctggccaatctggtggagcagaacatctcagtg
cggcggcgccagggggtcagcattggccggctccacaagcagcggaagccggaccggcgg
aaacgctcccgtccctataaggccaagcgccagtga

DBGET integrated database retrieval system