KEGG   Bos taurus (cow): 100125266Help
Entry
100125266         CDS       T01008                                 

Definition
alkaline phosphatase-like
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
bta  Bos taurus (cow)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100125266
Enzymes [BR:bta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     100125266
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100125266
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
2
AA seq 533 aa AA seqDB search
MQGACVLLLLGLHLQLSLGLVPVEEEDPAFWNRQAAQALDVAKKLQPIQTAAKNVILFLG
DGMGVPTVTATRILKGQMNGKLGPETPLAMDQFPYVALSKTYNVDRQVPDSAGTATAYLC
GVKGNYRTIGVSAAARYNQCKTTRGNEVTSVMNRAKKAGKSVGVVTTTRVQHASPAGAYA
HTVNRNWYSDADLPADAQMNGCQDIAAQLVNNMDIDVILGGGRKYMFPVGTPDPEYPDDA
SVNGVRKDKQNLVQAWQAKQQGAQYVWNRTALLQAADDSSVTHLMGLFEPADMKYNVQQD
PTKDPTLQEMTEVALRVLSRNPRGFYLFVEGGRIDHGHHDDKAYMALTEAVMFDNAIAKA
NELTSELDTLILVTADHSHVFSFGGYTLRGTSIFGLAPSKALDSKSYTSILYGNGPGYAL
GGGSRPDVNDSTSEDPSYQQQAAVPLASETHGGEDVAVFARGPQAHLVHGVQEETFVAHI
MAFAGCVEPYTDCNLPAPTTATSIPDAAHLAASPPPLALLAGAMLLLLAPTLY
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgcagggggcctgcgtgctgctgctgctgggcctgcatctacagctctccctaggcctc
gtcccagttgaggaggaagaccccgccttctggaaccgccaggcagcccaggccctcgat
gtggctaagaagctgcagcccatccagacagccgccaagaatgtcatcctcttcttgggg
gatgggatgggggtgcctacggtgacagccactcggatcctaaaggggcagatgaatggc
aaactgggacctgagacacccctggccatggaccagttcccatacgtggctctgtccaag
acatacaacgtggacagacaggtgccagacagcgcaggcactgccactgcctacctgtgt
ggggtcaagggcaactacagaaccattggtgtaagtgcagccgcccgctacaaccagtgc
aaaacgacacgtgggaatgaggtcacgtctgtgatgaaccgggccaagaaagcagggaag
tccgtgggagtggtgaccaccaccagggtgcagcatgcctccccagccggggcctacgcg
cacacggtgaaccgaaactggtactcagacgccgacctgcctgctgatgcacagatgaat
ggctgccaggacatcgccgcacagctggtcaacaacatggatattgacgtgatcctgggt
ggaggccgaaaatacatgtttcctgtggggaccccagaccctgaatacccagatgatgcc
agtgtgaatggagtccggaaggacaagcagaacctggtgcaggcatggcaggccaagcag
cagggagcccagtatgtgtggaaccgcactgcgctccttcaggcggccgatgactccagt
gtaacacacctcatgggcctctttgagccggcagacatgaagtataatgttcagcaagac
cccaccaaggacccgaccctgcaggaaatgacagaggtggccctgcgagtgctaagcagg
aaccccaggggcttctacctctttgtggagggaggccgcattgaccacggtcaccatgat
gacaaagcttatatggcactgaccgaggcggtcatgtttgacaatgccatcgccaaggct
aatgagctcactagcgaactggacacgctgatccttgtcactgcagaccactctcatgtc
ttctcttttggtggctatacactgcgtgggacctccatttttggtctggcccccagcaag
gccttagacagcaagtcctacacctccatcctctatggcaatggccctggctatgcgctt
ggcgggggctcgaggcccgatgttaatgacagcacaagcgaggacccctcgtaccagcag
caggcggccgtgcccctggctagcgagacccacgggggcgaggacgtggcggtgttcgcg
cgcggcccgcaggcgcacctggtgcacggcgtgcaggaggagaccttcgtggcgcacatc
atggcctttgcgggctgcgtggagccctacaccgactgcaatctgccagcccccaccacc
gccaccagcatccccgacgccgcgcacctggcggccagcccgcctccactggcgctgctg
gctggggcgatgctgctgctgctggcgcccaccttgtactaa

DBGET integrated database retrieval system