KEGG   Bos taurus (cow): 100125266Help
Entry
100125266         CDS       T01008                                 

Definition
alkaline phosphatase-like
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
bta  Bos taurus (cow)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bta00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
2
AA seq 533 aa AA seqDB search
MQGACVLLLLGLHLQLSLGLVPVEEEDPAFWNRQAAQALDVAKKLQPIQTAAKNVILFLG
DGMGVPTVTATRILKGQMNGKLGPETPLAMDQFPYVALSKTYNVDRQVPDSAGTATAYLC
GVKGNYRTIGVSAAARYNQCKTTRGNEVTSVMNRAKKAGKSVGVVTTTRVQHASPAGAYA
HTVNRNWYSDADLPADAQMNGCQDIAAQLVNNMDIDVILGGGRKYMFPVGTPDPEYPDDA
SVNGVRKDKQNLVQAWQAKQQGAQYVWNRTALLQAADDSSVTHLMGLFEPADMKYNVQQD
PTKDPTLQEMTEVALRVLSRNPRGFYLFVEGGRIDHGHHDDKAYMALTEAVMFDNAIAKA
NELTSELDTLILVTADHSHVFSFGGYTLRGTSIFGLAPSKALDSKSYTSILYGNGPGYAL
GGGSRPDVNDSTSEDPSYQQQAAVPLASETHGGEDVAVFARGPQAHLVHGVQEETFVAHI
MAFAGCVEPYTDCNLPAPTTATSIPDAAHLAASPPPLALLAGAMLLLLAPTLY
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgcagggggcctgcgtgctgctgctgctgggcctgcatctacagctctccctaggcctc
gtcccagttgaggaggaagaccccgccttctggaaccgccaggcagcccaggccctcgat
gtggctaagaagctgcagcccatccagacagccgccaagaatgtcatcctcttcttgggg
gatgggatgggggtgcctacggtgacagccactcggatcctaaaggggcagatgaatggc
aaactgggacctgagacacccctggccatggaccagttcccatacgtggctctgtccaag
acatacaacgtggacagacaggtgccagacagcgcaggcactgccactgcctacctgtgt
ggggtcaagggcaactacagaaccattggtgtaagtgcagccgcccgctacaaccagtgc
aaaacgacacgtgggaatgaggtcacgtctgtgatgaaccgggccaagaaagcagggaag
tccgtgggagtggtgaccaccaccagggtgcagcatgcctccccagccggggcctacgcg
cacacggtgaaccgaaactggtactcagacgccgacctgcctgctgatgcacagatgaat
ggctgccaggacatcgccgcacagctggtcaacaacatggatattgacgtgatcctgggt
ggaggccgaaaatacatgtttcctgtggggaccccagaccctgaatacccagatgatgcc
agtgtgaatggagtccggaaggacaagcagaacctggtgcaggcatggcaggccaagcag
cagggagcccagtatgtgtggaaccgcactgcgctccttcaggcggccgatgactccagt
gtaacacacctcatgggcctctttgagccggcagacatgaagtataatgttcagcaagac
cccaccaaggacccgaccctgcaggaaatgacagaggtggccctgcgagtgctaagcagg
aaccccaggggcttctacctctttgtggagggaggccgcattgaccacggtcaccatgat
gacaaagcttatatggcactgaccgaggcggtcatgtttgacaatgccatcgccaaggct
aatgagctcactagcgaactggacacgctgatccttgtcactgcagaccactctcatgtc
ttctcttttggtggctatacactgcgtgggacctccatttttggtctggcccccagcaag
gccttagacagcaagtcctacacctccatcctctatggcaatggccctggctatgcgctt
ggcgggggctcgaggcccgatgttaatgacagcacaagcgaggacccctcgtaccagcag
caggcggccgtgcccctggctagcgagacccacgggggcgaggacgtggcggtgttcgcg
cgcggcccgcaggcgcacctggtgcacggcgtgcaggaggagaccttcgtggcgcacatc
atggcctttgcgggctgcgtggagccctacaccgactgcaatctgccagcccccaccacc
gccaccagcatccccgacgccgcgcacctggcggccagcccgcctccactggcgctgctg
gctggggcgatgctgctgctgctggcgcccaccttgtactaa

DBGET integrated database retrieval system