KEGG   Bos taurus (cow): 100125883Help
Entry
100125883         CDS       T01008                                 

Gene name
KAT8, MYST1
Definition
(RefSeq) lysine acetyltransferase 8
  KO
K11308  histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
bta  Bos taurus (cow)
Brite
Enzymes [BR:bta01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100125883 (KAT8)
Chromosome [BR:bta03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100125883 (KAT8)
   HAT complexes
    NSL complex
     100125883 (KAT8)
    MSL complex
     100125883 (KAT8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MOZ_SAS Tudor-knot Myosin_head Acetyltransf_7 HTH_9 SAWADEE
Motif
Other DBs
NCBI-GeneID: 100125883
NCBI-ProteinID: NP_001098953
BGD-bta: BT22857
Ensembl: ENSBTAG00000010511
UniProt: A3KN50
Position
25
AA seq 458 aa AA seqDB search
MAAQGAAAAVAAATSGVAGEGEPGPGENAAVEGTAPSPGRISPPTPARGEPEVTVEIGET
YLCRRPDSTWHSAEVIQSRVNDQEGREEFYVHYVGFNRRLDEWVDKNRLALTKTVKDAVQ
KNSEKYLSELAEQPERKITRNQKRKHDEINHVQKTYAEMDPTTAALEKEHEAITKVKYVD
KIHIGNYEIDAWYFSPFPEDYGEQPKLWLCEYCLKYMKYEKSYRFHLGQCQWRQPPGKEI
YRKSNISVYEVDGKDHKIYCQNLCLLAKLFLDHKTLYFDVEPFVFYILTEVDRQGAHIVG
YFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLESTVGSPEKPLSDLGKLS
YRSYWSWVLLEILRDFRGTLSIKDLSQMTSITQNDIISTLQSLNMVKYWKGQHVICVTPK
LVEEHLKSAQYKKPPITVDSVCLKWAPPKHKQVKLSKK
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggcggcacagggagcagctgcggcggttgcggcggcgacttcaggggtcgcgggggag
ggcgagcccggacccggggagaatgcggcggtcgaggggaccgctccgtccccaggccgc
atctctccgccgaccccggcgcgcggcgagcctgaagtcaccgtggagatcggagaaaca
tacctatgccggcggcccgatagcacctggcattctgctgaagtgatccagtctcgagtg
aacgatcaagaaggccgagaggaattctatgtacactacgtgggctttaaccggcgattg
gatgaatgggtcgacaagaaccggctggcgctgaccaaaacagtgaaagatgctgtgcag
aagaactcagagaagtacctgagtgagctggccgagcagccggagcgcaagatcactcga
aaccaaaaacgcaagcatgatgagatcaaccacgtgcagaagacctatgcagagatggat
cccacaacagcagccttggagaaggaacatgaggcgattaccaaggtgaagtacgtggac
aagatccacattgggaactacgaaatcgacgcctggtacttctccccattccctgaagac
tatggggaacagcccaagctctggctctgcgagtactgtctcaagtatatgaaatacgag
aagagctaccgcttccacttgggccagtgccagtggcggcaacccccaggaaaggagatc
taccgcaagagcaacatctctgtgtatgaagtggatggcaaagaccacaagatttactgt
cagaacctatgtctgctggccaagctcttcctggaccataagacgctatactttgatgtg
gagccgttcgtcttttacatcttgacggaggtggacaggcagggggcccacatcgtcggc
tacttctcaaaggagaaggagtccccagatgggaacaacgtggcctgtatcctgacgctg
cccccctaccagcgccgtggctacgggaagttcctcattgctttcagctatgagctctcg
aagctggagagcacagtcggctccccagagaagccactgtctgacctgggcaagctcagc
taccgcagctactggtcctgggtcctgctggagatcttgcgagacttccggggcaccctg
tccatcaaggaccttagccagatgacgagcatcactcagaatgacatcatcagcaccctc
cagtccctcaacatggtcaagtactggaagggccagcacgtgatctgtgtcacacccaag
ctggtggaggaacacctcaaaagcgctcagtataagaaaccacccatcacagtggactcc
gtctgcctcaagtgggcaccccccaagcacaagcaagtcaaactctccaagaagtga

DBGET integrated database retrieval system