KEGG   Bos taurus (cow): 100125883Help
Entry
100125883         CDS       T01008                                 

Gene name
KAT8, MYST1
Definition
K(lysine) acetyltransferase 8 (EC:2.3.1.48)
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
bta  Bos taurus (cow)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
25
AA seq 458 aa AA seqDB search
MAAQGAAAAVAAATSGVAGEGEPGPGENAAVEGTAPSPGRISPPTPARGEPEVTVEIGET
YLCRRPDSTWHSAEVIQSRVNDQEGREEFYVHYVGFNRRLDEWVDKNRLALTKTVKDAVQ
KNSEKYLSELAEQPERKITRNQKRKHDEINHVQKTYAEMDPTTAALEKEHEAITKVKYVD
KIHIGNYEIDAWYFSPFPEDYGEQPKLWLCEYCLKYMKYEKSYRFHLGQCQWRQPPGKEI
YRKSNISVYEVDGKDHKIYCQNLCLLAKLFLDHKTLYFDVEPFVFYILTEVDRQGAHIVG
YFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLESTVGSPEKPLSDLGKLS
YRSYWSWVLLEILRDFRGTLSIKDLSQMTSITQNDIISTLQSLNMVKYWKGQHVICVTPK
LVEEHLKSAQYKKPPITVDSVCLKWAPPKHKQVKLSKK
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggcggcacagggagcagctgcggcggttgcggcggcgacttcaggggtcgcgggggag
ggcgagcccggacccggggagaatgcggcggtcgaggggaccgctccgtccccaggccgc
atctctccgccgaccccggcgcgcggcgagcctgaagtcaccgtggagatcggagaaaca
tacctatgccggcggcccgatagcacctggcattctgctgaagtgatccagtctcgagtg
aacgatcaagaaggccgagaggaattctatgtacactacgtgggctttaaccggcgattg
gatgaatgggtcgacaagaaccggctggcgctgaccaaaacagtgaaagatgctgtgcag
aagaactcagagaagtacctgagtgagctggccgagcagccggagcgcaagatcactcga
aaccaaaaacgcaagcatgatgagatcaaccacgtgcagaagacctatgcagagatggat
cccacaacagcagccttggagaaggaacatgaggcgattaccaaggtgaagtacgtggac
aagatccacattgggaactacgaaatcgacgcctggtacttctccccattccctgaagac
tatggggaacagcccaagctctggctctgcgagtactgtctcaagtatatgaaatacgag
aagagctaccgcttccacttgggccagtgccagtggcggcaacccccaggaaaggagatc
taccgcaagagcaacatctctgtgtatgaagtggatggcaaagaccacaagatttactgt
cagaacctatgtctgctggccaagctcttcctggaccataagacgctatactttgatgtg
gagccgttcgtcttttacatcttgacggaggtggacaggcagggggcccacatcgtcggc
tacttctcaaaggagaaggagtccccagatgggaacaacgtggcctgtatcctgacgctg
cccccctaccagcgccgtggctacgggaagttcctcattgctttcagctatgagctctcg
aagctggagagcacagtcggctccccagagaagccactgtctgacctgggcaagctcagc
taccgcagctactggtcctgggtcctgctggagatcttgcgagacttccggggcaccctg
tccatcaaggaccttagccagatgacgagcatcactcagaatgacatcatcagcaccctc
cagtccctcaacatggtcaagtactggaagggccagcacgtgatctgtgtcacacccaag
ctggtggaggaacacctcaaaagcgctcagtataagaaaccacccatcacagtggactcc
gtctgcctcaagtgggcaccccccaagcacaagcaagtcaaactctccaagaagtga

DBGET integrated database retrieval system