KEGG   Bos taurus (cow): 100137883Help
Entry
100137883         CDS       T01008                                 

Definition
thymosin beta-4-like
Orthology
K05764  
thymosin, beta 4
Organism
bta  Bos taurus (cow)
Pathway
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:bta00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100137883
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 44 aa AA seqDB search
MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
NT seq 135 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaaacccgatatggctgagattgagaagttcgataagtcgaaattgaagaaa
acggaaacgcaagagaaaaatccactgccttcgaaagaaacgattgaacaggagaagcaa
gcaggcgagtcgtaa

DBGET integrated database retrieval system