KEGG   Bos taurus (cow): 100138100Help
Entry
100138100         CDS       T01008                                 

Gene name
SETDB1
Definition
SET domain, bifurcated 1 (EC:2.1.1.43)
Orthology
K11421  
histone-lysine N-methyltransferase SETDB [EC:2.1.1.43]
Organism
bta  Bos taurus (cow)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100138100 (SETDB1)
Enzymes [BR:bta01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100138100 (SETDB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 1290 aa AA seqDB search
MSSLPGCLGLAAATAAVESEEIAELQQSVVEELGISMEELRQFIDEELEKMDCVQQRKKQ
LAELETWVIQKESEVAHVDQLFDDASRAVTNCESLVKDFYSKLGLQYRDSSSEDEASRPT
EIIEIPDEDDDVLSIDSGDAGNRTPKDQKLREAMAALRKSAQDVQKFMDAVNKKSNSQDL
HKGTLSQMPGELSKDGDLVVNMRILGKKRTKTWHKGTLIAIQTVGSGKKYKVKFDNKGKS
LLSGNHIAYDYHPPADKLYVGSRVVAKYKDGNQVWLYAGIVAETPNVKNKLRFLIFFDDG
YASYVTQSELYPICRPLKKTWEDIEDISCRDFIEEYITAYPNRPMVLLKSGQLIKTEWEG
TWWKSRVEEVDGSLVRILFLDDKRCEWIYRGSTRLEPMFSMKTSSASALEKKQGGQLRTR
PNMGAVRSKGPVVQYTQDLTSTGTQFKPMEPPQPTAPPAPPAPPGPALSPQAGDSESLEG
QLAQSRKQVAKKSTSFRPGSVGSGHSSPTSPALSENAPGGKPGINQTYRSPLGSTTSAPA
PPAPPAPPAFHGMLERAPAEPSYRAPMEKLFYLPHVCSYTCLSRVRPMRSEQYRGKNPLL
VPLLYDFRRMTARRRVNRKMGFHVIYKTPCGLCLRTMQEIERYLFETGCDFLFLEMFCLD
PYVLVDRKFQPYKPFYYILDITYGKEDVPLSCVNEIDTTPPPQVAYSKERIPGKGVFINT
GPEFLVGCDCKDGCRDKSKCACHQLTIQATACTPGGQINPNSGYQYKRLEECLPTGVYEC
NKRCKCDPNMCTNRLVQHGLQVRLQLFKTQNKGWGIRCLDDIAKGSFVCIYAGKILTDDF
ADKEGLEMGDEYFANLDHIESVENFKEGYESDAPCSSDSSGVDLKDQEDGNSGTEDPEES
NDDSSDDNFCKDEDFSTSSVWRSYATRRQTRGQKENGLSEMSSKDSRPPDLGPPHIPVPP
SIPVGGCNPPSSEETPKNKVASWLSCNSVSEGGFADSDSRSSFKTSEGGEGRTGGSRGEA
EKASTSGLGFKDEGDIKQAKKEDPDDRNRMSIVTESSRNYGYNPSPVKPEGLRRPPSKTS
MHQSRRLMASAQPNPDDILTLSSSTESEGESGTSRKPTAGQTSAAAVDSDDIQTISSGSE
GDDFEDKKNMSGPMKRQVAVKSTRGFALKSTHGIAIKSTNMASVEKGESAPIRKNTRQFY
DGEESCYIIDAKLEGNLGRYLNHSCSPNLFVQNVFVDTHDLRFPWVAFFASKRIRAGTEL
TWDYNYEVGSVEGKELLCCCGAIECRGRLL
NT seq 3873 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccctccctgggtgccttggtttggcagctgcaacagcagcagtggagtctgaa
gaaattgcagagctgcaacagtccgtggttgaggagctgggcatctcaatggaggagctt
cgacagttcattgatgaagaactggaaaagatggactgtgtacagcagcgcaagaagcaa
ctagcagagttggagacttgggtaatacaaaaggaatctgaggtggcccatgttgaccaa
ctctttgatgatgcatccagggcagtgactaactgtgagtctttggtgaaggacttttat
tccaaactgggactacagtaccgggacagcagctctgaagatgaagcttcccggcctaca
gaaataattgagattcctgatgaagacgatgatgtccttagtattgattcaggtgatgct
gggaacagaactccaaaagaccagaagctccgtgaagctatggctgccttaagaaaatcg
gctcaagatgtccagaagttcatggatgctgtcaacaagaagagtaattcccaggatcta
cacaaaggaaccttgagtcagatgcctggagaattgagcaaagatggtgacttggtcgtc
aacatgcgcatccttggcaaaaaaagaactaagacgtggcacaaaggcacccttattgcc
atccagacagttgggtcagggaagaagtacaaggtgaaatttgacaacaaaggaaagagt
cttctgtcaggaaaccacattgcctacgattaccaccctcctgctgacaagttgtatgtg
ggcagtcgagtagtggccaaatacaaagatgggaatcaggtctggctctatgctggcatt
gtagctgagacaccaaacgtcaaaaacaagctcaggtttctcattttctttgatgatggc
tatgcttcctatgtgacacagtctgaactgtatcccatttgccggccactgaaaaagact
tgggaggacatagaagacatctcctgccgagacttcatagaagagtatatcaccgcttac
cccaaccgccccatggtgttgctcaagagtggccagctgatcaagaccgagtgggaaggc
acgtggtggaagtcccgagtcgaggaggtggacggcagcctagtcaggatcctctttctg
gatgacaaaagatgtgaatggatctatcgaggctctacgcgactggagcccatgttcagc
atgaagacatcatccgcctctgcactagagaagaagcaagggggacagctcagaacacgt
ccaaatatgggtgctgtgagaagcaaaggtcctgtggtccagtacactcaggatctaaca
agtactggaacccagttcaagcctatggaacccccacagccgacagccccacctgcccca
cctgccccacctggtccagctctgtccccccaggcaggtgacagtgaaagcttggaaggc
cagcttgcccaatctcggaagcaggtagccaaaaaaagcacatctttccggccaggatct
gtgggctctggtcattcctcccctacatcccctgcactcagtgaaaatgcccctggtggg
aaacctgggatcaatcagacatataggtcacctttaggctccacaacctctgccccagca
cccccagctcccccagcacccccagccttccatggcatgctggagcgggcccctgcagag
ccctcctaccgtgcccccatggagaagcttttctacttacctcatgtctgcagctatact
tgtctgtctcgagtcagacctatgagaagtgagcagtatcggggcaagaaccctctgtta
gtcccactactctatgactttcggcgaatgacagcccggcgccgagtaaaccgcaagatg
ggctttcatgttatctataagacaccctgtggcctctgccttcggacaatgcaggagatt
gagcgttacctttttgagactggctgtgacttcctcttcctggagatgttctgtttggat
ccatatgttcttgtggaccgaaagtttcagccctataagcctttttactatattttggac
atcacctatgggaaggaagacgttcctctatcctgcgttaacgagattgacacgactccc
ccacctcaggtggcctacagcaaggaacggatcccgggcaagggtgttttcattaacaca
ggccctgagtttcttgtcggctgtgactgcaaagatgggtgccgggacaagtccaagtgt
gcctgccatcagctaactatccaggctacagcctgcaccccaggaggccaaatcaacccc
aactctggctaccaatacaagagactagaagaatgtctgcccacaggagtttatgagtgt
aacaaacgctgcaaatgtgaccctaacatgtgcacaaaccggttggtacagcatggcctg
caggttcgtctgcagctcttcaagacccagaacaagggctggggtatccgttgcttggat
gacattgccaaaggctcctttgtctgtatttatgcagggaagatcctgacagatgacttt
gctgacaaggagggcctagaaatgggtgatgagtactttgccaatctggaccatattgag
agcgtggagaacttcaaggaggggtatgagagtgatgccccctgctcctctgacagcagt
ggtgtagacttgaaggaccaggaagacggcaacagtggtacagaggaccccgaggagtcc
aatgacgacagctcagatgacaacttctgtaaggacgaggacttcagcaccagctcggtg
tggcgcagctatgctacccgacggcagacccggggccagaaggagaatggattgtctgag
atgtcttccaaggactctcgccccccagacctagggcccccacatattcctgtccctcca
tcaatccctgtaggtggctgcaatccaccttcctctgaagagacacctaagaacaaagtg
gcctcgtggttgagctgcaacagtgtcagtgaaggtggctttgctgactctgatagccgt
tcatccttcaagactagtgaaggtggggaaggccgcactgggggaagcagaggggaagct
gagaaggcttccacctcagggcttggcttcaaggatgagggagacatcaagcaggccaag
aaagaggaccctgatgaccgaaacaggatgtcaatagttactgaaagctctcgaaattat
ggttacaatccttctcctgtgaagcctgaaggacttcgccgcccaccaagtaaaactagt
atgcatcagagccgacgactcatggcctctgctcagccaaaccctgatgatatcctgacc
ctgtccagcagcacagaaagtgagggggaaagtgggaccagccggaagcccactgctggc
cagacttcagccgcagccgtggacagtgatgatatccagaccatctcctctggctctgaa
ggggatgactttgaggacaagaagaacatgtctggtccaatgaagcgccaagtggcagta
aaatccacccggggttttgctttgaaatcaacccatggcattgccattaaatcaaccaac
atggcatctgtggaaaagggggagagtgcacccattcgtaagaacacacgccagttctat
gatggggaggagtcttgctacatcatcgatgccaagcttgaaggcaacctgggccgctac
ctcaatcacagttgcagccctaacctgtttgtccagaatgtcttcgtggatactcatgat
ctccgcttcccgtgggtggccttcttcgccagcaagagaatccgggctggcaccgagctt
acctgggactacaactatgaggtgggcagcgtggaaggcaaggagttgctttgctgctgc
ggggccatcgaatgccgagggcgtcttctttag

DBGET integrated database retrieval system