KEGG   Bos taurus (cow): 100138100Help
Entry
100138100         CDS       T01008                                 

Gene name
SETDB1
Definition
(RefSeq) SET domain, bifurcated 1 (EC:2.1.1.43)
  KO
K11421  
histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43]
Organism
bta  Bos taurus (cow)
Pathway
Lysine degradation
Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100138100 (SETDB1)
 Cellular Processes
  Cellular commiunity
   04550 Signaling pathways regulating pluripotency of stem cells
    100138100 (SETDB1)
Enzymes [BR:bta01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100138100 (SETDB1)
Chromosome [BR:bta03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100138100 (SETDB1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100138100 (SETDB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 1290 aa AA seqDB search
MSSLPGCLGLAAATAAVESEEIAELQQSVVEELGISMEELRQFIDEELEKMDCVQQRKKQ
LAELETWVIQKESEVAHVDQLFDDASRAVTNCESLVKDFYSKLGLQYRDSSSEDEASRPT
EIIEIPDEDDDVLSIDSGDAGNRTPKDQKLREAMAALRKSAQDVQKFMDAVNKKSNSQDL
HKGTLSQMPGELSKDGDLVVNMRILGKKRTKTWHKGTLIAIQTVGSGKKYKVKFDNKGKS
LLSGNHIAYDYHPPADKLYVGSRVVAKYKDGNQVWLYAGIVAETPNVKNKLRFLIFFDDG
YASYVTQSELYPICRPLKKTWEDIEDISCRDFIEEYITAYPNRPMVLLKSGQLIKTEWEG
TWWKSRVEEVDGSLVRILFLDDKRCEWIYRGSTRLEPMFSMKTSSASALEKKQGGQLRTR
PNMGAVRSKGPVVQYTQDLTSTGTQFKPMEPPQPTAPPAPPAPPGPALSPQAGDSESLEG
QLAQSRKQVAKKSTSFRPGSVGSGHSSPTSPALSENAPGGKPGINQTYRSPLGSTTSAPA
PPAPPAPPAFHGMLERAPAEPSYRAPMEKLFYLPHVCSYTCLSRVRPMRSEQYRGKNPLL
VPLLYDFRRMTARRRVNRKMGFHVIYKTPCGLCLRTMQEIERYLFETGCDFLFLEMFCLD
PYVLVDRKFQPYKPFYYILDITYGKEDVPLSCVNEIDTTPPPQVAYSKERIPGKGVFINT
GPEFLVGCDCKDGCRDKSKCACHQLTIQATACTPGGQINPNSGYQYKRLEECLPTGVYEC
NKRCKCDPNMCTNRLVQHGLQVRLQLFKTQNKGWGIRCLDDIAKGSFVCIYAGKILTDDF
ADKEGLEMGDEYFANLDHIESVENFKEGYESDAPCSSDSSGVDLKDQEDGNSGTEDPEES
NDDSSDDNFCKDEDFSTSSVWRSYATRRQTRGQKENGLSEMSSKDSRPPDLGPPHIPVPP
SIPVGGCNPPSSEETPKNKVASWLSCNSVSEGGFADSDSRSSFKTSEGGEGRTGGSRGEA
EKASTSGLGFKDEGDIKQAKKEDPDDRNRMSIVTESSRNYGYNPSPVKPEGLRRPPSKTS
MHQSRRLMASAQPNPDDILTLSSSTESEGESGTSRKPTAGQTSAAAVDSDDIQTISSGSE
GDDFEDKKNMSGPMKRQVAVKSTRGFALKSTHGIAIKSTNMASVEKGESAPIRKNTRQFY
DGEESCYIIDAKLEGNLGRYLNHSCSPNLFVQNVFVDTHDLRFPWVAFFASKRIRAGTEL
TWDYNYEVGSVEGKELLCCCGAIECRGRLL
NT seq 3873 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccctccctgggtgccttggtttggcagctgcaacagcagcagtggagtctgaa
gaaattgcagagctgcaacagtccgtggttgaggagctgggcatctcaatggaggagctt
cgacagttcattgatgaagaactggaaaagatggactgtgtacagcagcgcaagaagcaa
ctagcagagttggagacttgggtaatacaaaaggaatctgaggtggcccatgttgaccaa
ctctttgatgatgcatccagggcagtgactaactgtgagtctttggtgaaggacttttat
tccaaactgggactacagtaccgggacagcagctctgaagatgaagcttcccggcctaca
gaaataattgagattcctgatgaagacgatgatgtccttagtattgattcaggtgatgct
gggaacagaactccaaaagaccagaagctccgtgaagctatggctgccttaagaaaatcg
gctcaagatgtccagaagttcatggatgctgtcaacaagaagagtaattcccaggatcta
cacaaaggaaccttgagtcagatgcctggagaattgagcaaagatggtgacttggtcgtc
aacatgcgcatccttggcaaaaaaagaactaagacgtggcacaaaggcacccttattgcc
atccagacagttgggtcagggaagaagtacaaggtgaaatttgacaacaaaggaaagagt
cttctgtcaggaaaccacattgcctacgattaccaccctcctgctgacaagttgtatgtg
ggcagtcgagtagtggccaaatacaaagatgggaatcaggtctggctctatgctggcatt
gtagctgagacaccaaacgtcaaaaacaagctcaggtttctcattttctttgatgatggc
tatgcttcctatgtgacacagtctgaactgtatcccatttgccggccactgaaaaagact
tgggaggacatagaagacatctcctgccgagacttcatagaagagtatatcaccgcttac
cccaaccgccccatggtgttgctcaagagtggccagctgatcaagaccgagtgggaaggc
acgtggtggaagtcccgagtcgaggaggtggacggcagcctagtcaggatcctctttctg
gatgacaaaagatgtgaatggatctatcgaggctctacgcgactggagcccatgttcagc
atgaagacatcatccgcctctgcactagagaagaagcaagggggacagctcagaacacgt
ccaaatatgggtgctgtgagaagcaaaggtcctgtggtccagtacactcaggatctaaca
agtactggaacccagttcaagcctatggaacccccacagccgacagccccacctgcccca
cctgccccacctggtccagctctgtccccccaggcaggtgacagtgaaagcttggaaggc
cagcttgcccaatctcggaagcaggtagccaaaaaaagcacatctttccggccaggatct
gtgggctctggtcattcctcccctacatcccctgcactcagtgaaaatgcccctggtggg
aaacctgggatcaatcagacatataggtcacctttaggctccacaacctctgccccagca
cccccagctcccccagcacccccagccttccatggcatgctggagcgggcccctgcagag
ccctcctaccgtgcccccatggagaagcttttctacttacctcatgtctgcagctatact
tgtctgtctcgagtcagacctatgagaagtgagcagtatcggggcaagaaccctctgtta
gtcccactactctatgactttcggcgaatgacagcccggcgccgagtaaaccgcaagatg
ggctttcatgttatctataagacaccctgtggcctctgccttcggacaatgcaggagatt
gagcgttacctttttgagactggctgtgacttcctcttcctggagatgttctgtttggat
ccatatgttcttgtggaccgaaagtttcagccctataagcctttttactatattttggac
atcacctatgggaaggaagacgttcctctatcctgcgttaacgagattgacacgactccc
ccacctcaggtggcctacagcaaggaacggatcccgggcaagggtgttttcattaacaca
ggccctgagtttcttgtcggctgtgactgcaaagatgggtgccgggacaagtccaagtgt
gcctgccatcagctaactatccaggctacagcctgcaccccaggaggccaaatcaacccc
aactctggctaccaatacaagagactagaagaatgtctgcccacaggagtttatgagtgt
aacaaacgctgcaaatgtgaccctaacatgtgcacaaaccggttggtacagcatggcctg
caggttcgtctgcagctcttcaagacccagaacaagggctggggtatccgttgcttggat
gacattgccaaaggctcctttgtctgtatttatgcagggaagatcctgacagatgacttt
gctgacaaggagggcctagaaatgggtgatgagtactttgccaatctggaccatattgag
agcgtggagaacttcaaggaggggtatgagagtgatgccccctgctcctctgacagcagt
ggtgtagacttgaaggaccaggaagacggcaacagtggtacagaggaccccgaggagtcc
aatgacgacagctcagatgacaacttctgtaaggacgaggacttcagcaccagctcggtg
tggcgcagctatgctacccgacggcagacccggggccagaaggagaatggattgtctgag
atgtcttccaaggactctcgccccccagacctagggcccccacatattcctgtccctcca
tcaatccctgtaggtggctgcaatccaccttcctctgaagagacacctaagaacaaagtg
gcctcgtggttgagctgcaacagtgtcagtgaaggtggctttgctgactctgatagccgt
tcatccttcaagactagtgaaggtggggaaggccgcactgggggaagcagaggggaagct
gagaaggcttccacctcagggcttggcttcaaggatgagggagacatcaagcaggccaag
aaagaggaccctgatgaccgaaacaggatgtcaatagttactgaaagctctcgaaattat
ggttacaatccttctcctgtgaagcctgaaggacttcgccgcccaccaagtaaaactagt
atgcatcagagccgacgactcatggcctctgctcagccaaaccctgatgatatcctgacc
ctgtccagcagcacagaaagtgagggggaaagtgggaccagccggaagcccactgctggc
cagacttcagccgcagccgtggacagtgatgatatccagaccatctcctctggctctgaa
ggggatgactttgaggacaagaagaacatgtctggtccaatgaagcgccaagtggcagta
aaatccacccggggttttgctttgaaatcaacccatggcattgccattaaatcaaccaac
atggcatctgtggaaaagggggagagtgcacccattcgtaagaacacacgccagttctat
gatggggaggagtcttgctacatcatcgatgccaagcttgaaggcaacctgggccgctac
ctcaatcacagttgcagccctaacctgtttgtccagaatgtcttcgtggatactcatgat
ctccgcttcccgtgggtggccttcttcgccagcaagagaatccgggctggcaccgagctt
acctgggactacaactatgaggtgggcagcgtggaaggcaaggagttgctttgctgctgc
ggggccatcgaatgccgagggcgtcttctttag

DBGET integrated database retrieval system