KEGG   Bos taurus (cow): 100139219Help
Entry
100139219         CDS       T01008                                 

Gene name
MTOR
Definition
(RefSeq) mechanistic target of rapamycin
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
bta  Bos taurus (cow)
Pathway
bta01521  EGFR tyrosine kinase inhibitor resistance
bta01522  Endocrine resistance
bta04012  ErbB signaling pathway
bta04066  HIF-1 signaling pathway
bta04072  Phospholipase D signaling pathway
bta04136  Autophagy - other
bta04140  Autophagy - animal
bta04150  mTOR signaling pathway
bta04151  PI3K-Akt signaling pathway
bta04152  AMPK signaling pathway
bta04211  Longevity regulating pathway
bta04213  Longevity regulating pathway - multiple species
bta04218  Cellular senescence
bta04371  Apelin signaling pathway
bta04630  Jak-STAT signaling pathway
bta04659  Th17 cell differentiation
bta04714  Thermogenesis
bta04910  Insulin signaling pathway
bta04919  Thyroid hormone signaling pathway
bta04920  Adipocytokine signaling pathway
bta04930  Type II diabetes mellitus
bta04931  Insulin resistance
bta05165  Human papillomavirus infection
bta05167  Kaposi's sarcoma-associated herpesvirus infection
bta05200  Pathways in cancer
bta05205  Proteoglycans in cancer
bta05206  MicroRNAs in cancer
bta05210  Colorectal cancer
bta05212  Pancreatic cancer
bta05214  Glioma
bta05215  Prostate cancer
bta05221  Acute myeloid leukemia
bta05224  Breast cancer
bta05225  Hepatocellular carcinoma
bta05226  Gastric cancer
bta05230  Central carbon metabolism in cancer
bta05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    100139219 (MTOR)
   04371 Apelin signaling pathway
    100139219 (MTOR)
   04630 Jak-STAT signaling pathway
    100139219 (MTOR)
   04066 HIF-1 signaling pathway
    100139219 (MTOR)
   04072 Phospholipase D signaling pathway
    100139219 (MTOR)
   04151 PI3K-Akt signaling pathway
    100139219 (MTOR)
   04152 AMPK signaling pathway
    100139219 (MTOR)
   04150 mTOR signaling pathway
    100139219 (MTOR)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100139219 (MTOR)
   04136 Autophagy - other eukaryotes
    100139219 (MTOR)
  Cell growth and death
   04218 Cellular senescence
    100139219 (MTOR)
 Organismal Systems
  Immune system
   04659 Th17 cell differentiation
    100139219 (MTOR)
  Endocrine system
   04910 Insulin signaling pathway
    100139219 (MTOR)
   04920 Adipocytokine signaling pathway
    100139219 (MTOR)
   04919 Thyroid hormone signaling pathway
    100139219 (MTOR)
  Aging
   04211 Longevity regulating pathway - mammal
    100139219 (MTOR)
   04213 Longevity regulating pathway - multiple species
    100139219 (MTOR)
  Environmental adaptation
   04714 Thermogenesis
    100139219 (MTOR)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100139219 (MTOR)
   05230 Central carbon metabolism in cancer
    100139219 (MTOR)
   05231 Choline metabolism in cancer
    100139219 (MTOR)
   05206 MicroRNAs in cancer
    100139219 (MTOR)
   05205 Proteoglycans in cancer
    100139219 (MTOR)
   05210 Colorectal cancer
    100139219 (MTOR)
   05212 Pancreatic cancer
    100139219 (MTOR)
   05225 Hepatocellular carcinoma
    100139219 (MTOR)
   05226 Gastric cancer
    100139219 (MTOR)
   05214 Glioma
    100139219 (MTOR)
   05221 Acute myeloid leukemia
    100139219 (MTOR)
   05215 Prostate cancer
    100139219 (MTOR)
   05224 Breast cancer
    100139219 (MTOR)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100139219 (MTOR)
   04931 Insulin resistance
    100139219 (MTOR)
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100139219 (MTOR)
   05165 Human papillomavirus infection
    100139219 (MTOR)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    100139219 (MTOR)
   01522 Endocrine resistance
    100139219 (MTOR)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100139219 (MTOR)
Protein kinases [BR:bta01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   100139219 (MTOR)
Membrane trafficking [BR:bta04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    100139219 (MTOR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAT PI3_PI4_kinase DUF3385 FRB_dom FATC HEAT_2 V-ATPase_H_N UME TMEM154 EPSP_synthase HEAT_EZ
Motif
Other DBs
NCBI-GeneID: 100139219
NCBI-ProteinID: XP_002694089
BGD-bta: BT29876
Ensembl: ENSBTAG00000015325
Position
16
AA seq 2550 aa AA seqDB search
MLGTGPAAATTAATTSSNVSVLQQFASGLKSRNEETRAKAAKELQHYVTMELREMSQEES
TRFYDQLNHHIFELVSSSDANERKGGILAIASLIGVEGGNATRIGRFANYLRNLLPSNDP
VVMEMASKAIGRLAMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVP
TFFFQQVQPFFDNIFVAVWDPKQAIREGAVAALRACLILTTQREPKEMQKPQWYRHTFEE
AEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYC
KDLMGFGTKPRHITPFTSFQSVQPQQSNALVGLLGYSSHQGLMGFGASPSPAKSMLVESR
CCRDLMEEKFDQVCQWVLKCRNSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMNHV
LSCVKKEKERTAAFQALGLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKAMQVDA
TVFTCISMLARAMGPGIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLL
KMLSLVLMHKPLRHPGMPKGLAHQLASPGLTTLPEASDVGSITLALRTLGSFEFEGHSLT
QFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSVHLISGHAHVVSQTAVQVVADVLSKLL
VVGITDPDPDIRYCVLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSS
MNPAFVMPFLRKMLIQILTELEHSGIGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALI
LKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVA
LWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHK
VNIGMIDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFR
DQSLSHHHTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLV
SFVKSHIRPYMDEIVTLMREFWVMNTSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLR
VFMHDNSSGRIVSIKLLAAIQLFGANLDDYLHLLLPPIVKLFDAPEAPLPSRKAALETVD
RLTESLDFTDYASRIIHPIVRTLDQSPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLV
RHRINHQRYDVLICRIVKGYTLADEEEDPLIYQHRMLRSGQGDALASGPVETGPMKKLHV
STINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNA
AFVSCWSELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGI
VLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAMKHF
GELEIQATWYEKLHEWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEK
WTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLA
QQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWW
ERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVD
PSRQLDHPLPTVHPQVTYAYMKNMWKSARKIDAFQHMQHFVQTMQQQAQHAIATEDQQHK
QELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYYSAATEHDRSWYKAWHAWAVMNFEA
VLHYKHQNQARDEKKKLRHASGANITNAATAATTAATATATTTSTEGSNSESEAESTENS
PTPSPLQKKVTEDLSKTLLMYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPDV
NEALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVA
SKSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLYF
GERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQ
AWDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAPS
LQVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKN
LSIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHLT
LMQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDR
HPSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRIT
CHTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILD
GVELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHDETL
DVPTQVELLIKQATSHENLCQCYIGWCPFW
NT seq 7653 nt NT seq  +upstreamnt  +downstreamnt
atgcttggaaccggccctgctgctgccaccacagctgccaccacatccagcaatgtgagc
gtcctgcagcagtttgccagcggcctgaagagccggaatgaagagactagggccaaagct
gccaaggagctccagcactacgtcaccatggagctccgagagatgagtcaagaggagtct
actcgcttctatgatcagctgaaccatcacatctttgaactggtgtccagctcagatgcc
aatgagaggaaaggtggcattttggccatagccagcctcataggagtggaaggtgggaat
gccactcgaattggaagatttgctaactaccttcggaacctccttccctccaacgaccca
gttgtcatggaaatggcatccaaggccatcggtcggctcgccatggcaggggacactttc
actgctgagtatgtggagtttgaggtgaagcgagccctggaatggctgggtgctgaccgc
aatgagggccggagacacgcggctgtcctggtgctccgtgagctggccatcagcgtcccc
accttcttcttccagcaagtgcagcccttctttgataatatttttgtggccgtgtgggac
cccaaacaggccatccgggaaggagctgtcgccgcccttcgtgcctgtctgatcctcacc
acccagcgggagccaaaagagatgcagaagccgcagtggtacaggcacacgtttgaagaa
gcagagaaagggtttgatgagaccttggccaaggagaagggcatgaatcgggatgaccgg
atccatggagccctgcttatcctcaatgagctggtccggatcagtagcatggagggagag
cgcctgagagaagaaatggaagaaatcacacagcagcagttggtccatgacaagtactgc
aaggatctcatgggttttggaacgaaaccccgtcacatcacccccttcaccagtttccag
tccgtgcagccccagcagtcaaatgccttggtggggctgctggggtacagctctcaccaa
ggcctcatgggctttggggcctcccccagcccagcaaagtccatgctggtggaaagtcgc
tgctgcagggacttgatggaggagaaatttgatcaggtgtgccagtgggtgctgaagtgc
aggaatagcaagaactcgctgatccaaatgacaatccttaatttgttgccccgcttggct
gccttccgaccttctgccttcacagatacccagtacctccaggataccatgaaccatgtc
ctgagctgcgtcaagaaggagaaggaacggacagcagcctttcaagccctggggctactt
tctgtggctgtgaggtctgagttcaaggtctatttacctcgtgtgctggacatcatccga
gcagccctgccccctaaggacttcgcccataagagacagaaggctatgcaagtggatgcc
acagtgttcacctgcatcagcatgctggcccgagccatggggccaggcatccaacaggac
atcaaggagctgctggagcccatgctggcggtgggcctgagccctgccctcacagctgtg
ctctatgacctgagccgtcagattccacagctgaaaaaggacatccaagacgggctcctg
aagatgctgtccctggtccttatgcacaaacccctccggcaccccggcatgcccaagggc
ctggcccatcagctggcttcccctggtctcacgaccctccctgaggccagtgatgtgggc
agcatcacccttgctctccgaactctcggcagttttgaatttgaaggccactctctgacc
cagtttgtccgccactgtgcggatcacttcctgaacagcgagcacaaggagatccgtatg
gaggccgcccgcacctgctcccgcctgctcacaccctctgtccacctcatcagtggccac
gctcatgtggtcagccagactgcagtgcaagtggtggcagatgtgctcagcaaactgctc
gtggttgggataaccgatcctgaccccgacatccgctactgtgtcttggcgtccctggac
gagcgctttgatgcacacctggcccaggcggagaacctgcaggccctgtttgtggctctg
aatgaccaggtgtttgagatccgggagctggccatctgcactgtgggccggctcagcagc
atgaacccagccttcgtcatgcccttcctgcgcaagatgctcatccagattctcacagag
ctggagcacagcggcattggaagaatcaaggagcagagtgcccgcatgctgggccacctg
gtctccaacgccccgcggctcatccgcccctacatggagcctattctgaaggctttaatt
ttgaaactgaaagatccagaccctgatccaaacccaggtgtgatcaataatgtcttggct
acgataggagagttggctcaggttagtggccttgaaatgaggaaatgggttgatgaactt
tttattatcatcatggacatgctccaagactcctctctgttggccaaaaggcaggtggct
ctgtggaccttggggcagttggtggccagcactggctacgtggtagagccctacaggaag
taccccacattgctggaggtgctgctgaactttctgaagactgagcaaaaccagggtaca
cggcgggaggctatccgtgtgttggggctcctaggggcattggatccctacaagcacaaa
gtgaacattggcatgatcgaccagtcccgggacgcttctgccgtcagcctgtcagagtcc
aagtcaagtcaggattcttctgactacagcaccagcgagatgctggtcaacatggggaac
ctgcctctagacgagttctacccggccgtgtccatggtggccctgatgcgcatcttccga
gaccagtccctctctcaccaccacaccatggttgtccaggctatcaccttcatcttcaag
tccctggggctcaagtgcgtgcagttcctgccccaggtcatgcccacattcctgaatgtc
attcgggtttgtgacggggccatccgggaatttctgttccagcagctgggaatgttagtg
tcctttgtgaagagccacatcagaccttacatggatgagatagtcacgctcatgagagaa
ttctgggtcatgaacacctccatccagagcacaatcattctcctcattgagcagattgtg
gtagccctcgggggtgaatttaagctctacctgccccagctgattccacacatgcttcgt
gtcttcatgcatgacaatagctcaggccgcatcgtctccatcaagttgctggctgcaatc
cagctgttcggtgccaacctggatgactatctgcatttgttgctgcccccgatcgtgaag
ttatttgacgcccccgaagccccattgccttctcgaaaggccgcgctagagactgtggac
cgtctgacagagtctctggatttcacggactatgcctctcggatcattcatccgattgta
cgcacactggaccagagcccagaactccgttccacagcaatggacacgttgtcttcactc
gtctttcagctgggaaagaagtaccaaattttcattccaatggtgaacaaagttctggtg
agacaccgaatcaaccatcagcgctacgatgtcctcatctgcaggatagtcaaggggtat
accctggctgacgaggaggaggaccctctgatttaccagcatcgaatgctgaggagcggc
caaggtgatgccttagccagtggaccagtggaaacggggcccatgaagaaactgcacgtc
agcaccatcaacctccaaaaggcctggggagctgccagaagggtttccaaagatgattgg
ttggaatggctgcggcggctgagcctggagctgctgaaggactcctcgtcaccctccctg
cgctcctgctgggccctggcacaggcctacaacccgatggccagggatctctttaacgct
gcgtttgtgtcctgctggtctgagctgaatgaggaccagcaggatgagctcatcagaagc
atcgagttggccctcacctcccaggacatcgcagaagtcacgcaaaccctcttaaatttg
gctgaattcatggaacacagtgacaagggccccctgcctttgagagatgacaatggcatt
gtcctgctgggcgagagagctgccaagtgccgagcatatgccaaagcgctgcactacaaa
gaactggagttccagaaaggtcccacccctgccattctcgagtctctcatcagcattaat
aataagctgcagcagccagaggcagctgctggggtgttggagtatgccatgaagcacttt
ggagagctggagatccaggctacctggtatgagaagctgcacgagtgggaagatgctctc
gtggcctatgataagaaaatggacaccaacaaggacgacccagagctgatgctgggccgc
atgcgctgcctcgaggccttgggggaatgggggcagcttcaccagcagtgctgtgaaaaa
tggactctggttaatgatgagacccaagccaagatggcccgcatggctgctgcagctgca
tggggtttaggtcagtgggacagcatggaagagtacacgtgtatgatccctcgggacacc
cacgacggggcattttatagagctgtgctggcgctacatcaggacctcttctccttggca
caacagtgcatcgacaaagcccgggacctactagacgcggagttaacggcgatggcggga
gagagctacagccgggcctatggggccatggtttcttgccacatgctgtctgagctggag
gaggttatccagtacaaacttgtgcccgagcgacgggagatcatccgccagatctggtgg
gagagactgcagggctgccagcgtattgtggaggactggcagaaaatcctcatggtgcgg
tcactcgtcgtcagccctcacgaggacatgaggacctggctcaagtacgcaagcctgtgt
ggcaagagtggcaggctggcacttgctcacaaaaccttagtgctgctcctgggagttgat
ccatctcggcaacttgaccatcctctgccaacggttcacccccaggtgacctacgcctac
atgaaaaatatgtggaagagcgcccgcaagattgatgccttccagcacatgcagcacttt
gttcagaccatgcagcagcaagcccagcatgccatcgccaccgaggaccagcagcacaag
caggagctgcacaagctcatggcccgatgtttcctgaaactcggggagtggcagctgaac
ctacagggcatcaacgagagcacgatccccaaagtcctgcagtactacagcgccgccaca
gagcacgaccgcagctggtacaaggcctggcatgcgtgggcagtgatgaactttgaggct
gtgctccactacaaacatcagaaccaagcccgcgacgagaagaagaagctgcgacacgcc
agtggggccaacatcactaacgcagccactgctgctaccacagcggccacggccactgcc
accaccaccagcaccgagggcagcaacagcgagagcgaggctgagagcaccgagaacagc
cctaccccgtctcctctgcagaagaaggtcactgaggatttgtccaaaaccctcttgatg
tacactgtccctgctgtccagggcttcttccgttccatctccttgtcacgaggcaacaac
ctccaggacacgctcagagtcctcaccttatggtttgattatggtcactggccagatgta
aatgaagccttagtggaaggggtgaaagcaatccagattgacacttggttacaggttata
cctcagctcattgcaagaattgatacgccaaggcccctggtgggacgtcttatccaccag
cttctcacagacattggtcggtaccacccccaggccctcatctacccactgacagtggcc
tccaagtccaccaccacagcccggcacaacgcagccaacaaaatcctgaagaacatgtgc
gaacacagcaacaccctggtgcagcaggccatgatggtgagtgaggagctgatccgagtg
gccatcctctggcacgagatgtggcatgaaggcctggaagaggcgtctcgcttgtacttt
ggggagaggaacgtgaaaggcatgttcgaggtgctggaacccctgcacgccatgatggag
cggggaccccagacactgaaggaaacatcctttaaccaggcatatggtcgagatttaatg
gaggcccaggaatggtgcaggaagtacatgaaatcagggaatgtcaaggacctcacccaa
gcctgggacctctattaccacgtattcagacgaatctccaagcagctgcctcagctcaca
tccttagagctgcagtacgtctcccccaaacttctgatgtgccgggatctggaactggct
gtgccgggaacttacgaccccaaccagcccatcattcgcattcagtccatcgcgccgtct
ctgcaagtcatcacatccaaacagaggccccggaagctgacgcttatgggcagcaacggg
cacgagtttgtcttcctcctgaagggccatgaggacttgcggcaggacgaacgggtgatg
cagctcttcggcctggtcaacacccttctggccaatgacccgacgtctcttcggaaaaac
ctcagcatccagagatacgctgtcattccattatcaaccaactcgggcctcatcggctgg
gtcccccactgtgacacactgcacgccctcatccgggactacagggagaaaaagaagatc
cttctcaacattgagcatcgcatcatgctgcggatggctccagactatgaccacctaact
ctgatgcagaaggtcgaggtgtttgagcacgccgtcaacaacacagctggggacgacctg
gccaaactgctgtggctgaagagccccagctccgaggtgtggtttgatcgaagaaccaat
tatacccgctctttagcggtcatgtctatggttgggtatattttgggcctgggcgataga
cacccatccaacctgatgctggaccggctgagtggaaagatcctgcacattgactttggg
gactgctttgaggttgctatgaccagagagaaattcccagagaaaattccatttagacta
acaagaatgctgaccaatgctatggaggtcacgggccttgatggcaactacaggatcacg
tgccacaccgtgatggaggtgctccgggagcacaaggacagcgtcatggccgtgctggaa
gccttcgtctatgaccccctgctgaactggaggctgatggacacaaataccaaaggtaac
aagcgatcacggacgaggacagattcctactctgctggccagtcagtagaaattttggat
ggtgtggaacttggggaaccagcccataagaaaacggggaccacagtgccagaatctatt
cattctttcatcggagatggtttggtgaaaccagaggccctaaataagaaagcaattcaa
attattaacagggttcgagacaagctcactggtcgggacttctctcatgacgaaaccctg
gatgtcccaacacaagtcgagctgctcatcaaacaagcgacatcccatgaaaacctctgc
cagtgctacattggctggtgtcctttctggtaa

DBGET integrated database retrieval system