KEGG   Bos taurus (cow): 100140210Help
Entry
100140210         CDS       T01008                                 

Gene name
USP30
Definition
ubiquitin specific peptidase 30 (EC:3.4.19.12)
Orthology
K11851  
ubiquitin carboxyl-terminal hydrolase 30 [EC:3.1.2.15]
Organism
bta  Bos taurus (cow)
Brite
Enzymes [BR:bta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100140210 (USP30)
Peptidases [BR:bta01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100140210 (USP30)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
Position
17
AA seq 517 aa AA seqDB search
MLSSRASAAMTAADRAIQRFLRTGAAVRYKVMKNWGVIGGIAAALAAGIYVIWGPITERK
KRRKGLVPGLVNLGNTCFMNSLLQGLSACPTFIKWLEEFTTQYTGGHKEPPQHQYLSLTL
LHLLKALSCQEVTDEEVLDASCLLDVLRMYRWQISSFEEQDAHELFHVITSSLEDERDRQ
PRVTHLFDVHSLEQQTEITPRQITCRTRGSPHPTSNHWKSQHPFHGRLTSNMVCKHCEHQ
SPVRFDTFDSLSLSIPASTWGHPLTLDHCLHHFISSESVRDVVCDNCTKIEAKGTLNGEK
VEHQRTTFVKQLKLGKLPQCLCIHLQRLSWSSHGTPLKRHEHVQFGEFLMMDIYKYHLLG
HKPGHRSPEQCEKAGPALELQDGPAAPKSVRNHPGGPKTQIFMNGACSPSLLPALPTPMP
FPLPAVPDYSSSTYLFQLMAVVVHHGDMHSGHFVTYRRSPPSAKNPVSASSQWLWVSDDT
VRKASLQEVLSSSAYLLFYERVLSKMQPQGREYKSEE
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgctgagctcccgggcctcggcggcgatgaccgcggccgacagggccatccagcgcttc
ctgcggaccggggcggccgtcagatacaaagtcatgaagaactggggtgttataggtgga
attgccgctgctcttgcagcaggaatctatgttatttggggtcccattacagaaagaaag
aagcgtagaaaagggcttgtgcctggccttgtcaacttggggaacacctgcttcatgaac
tccctgctgcagggcctgtccgcctgccccaccttcatcaagtggctggaagagttcacc
acccagtacactgggggtcacaaggagcccccccaacaccagtacttatcgttaacgctg
ttgcacctcctgaaagctttatcctgccaagaggtcactgacgaagaggtcttggatgca
agctgcttgttggacgtcttaagaatgtaccgatggcagatctcttcgtttgaagagcag
gacgcccacgagttattccatgtgatcacttcatcactggaggatgagcgggaccgccag
ccccgggtcacacatctgtttgatgtgcattccctggagcagcagacagaaataactccc
agacagatcacctgccgcaccagagggtcaccacatcccacatccaaccactggaagtct
cagcatccttttcacggacgactcacgagtaacatggtctgcaaacactgtgagcaccag
agtcccgttcgattcgataccttcgacagtctttccctcagtattccagcctccacatgg
ggtcatccactgaccctggaccactgccttcaccacttcatctcgtcagaatccgtgcgg
gatgtcgtctgtgacaactgtacgaagattgaggcaaaagggacgctgaatggggagaag
gtggaacaccagaggaccacatttgtcaaacaattaaaactggggaagctcccgcagtgc
ctgtgcatccacctccagcggctgagctggtccagccacggcacacccctgaagcggcat
gagcacgtgcagttcggcgagttcctgatgatggacatctacaagtaccacctcctggga
cacaagcccggtcaccgcagccccgagcagtgtgagaaagcagggcccgcgctggagctg
caggacgggccggcagcccccaagtcagttcgcaatcacccggggggccccaaaacacag
attttcatgaacggcgcctgctccccgtctttgttgcccgccctgccgacccccatgcct
ttccccctcccagctgttcctgactacagctcctccacatacctcttccagctgatggcc
gtggtcgtccaccacggggacatgcactctggacacttcgtgacctaccggcgctccccg
ccctcggccaagaaccctgtctccgccagcagccagtggctgtgggtctccgacgacact
gtccgcaaggccagcctgcaggaggtgctgtcctccagcgcctacctcctgttctacgag
cgcgtcctctccaagatgcagccgcagggtcgggagtacaagtctgaggaatga

DBGET integrated database retrieval system