KEGG   Bos taurus (cow): 100140439Help
Entry
100140439         CDS       T01008                                 

Gene name
POM121L2
Definition
POM121 membrane glycoprotein-like 2
Orthology
K14316  
nuclear pore complex protein Nup121
Organism
bta  Bos taurus (cow)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:bta00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100140439 (POM121L2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
Position
23
AA seq 1030 aa AA seqDB search
MGSYLGKLGLSPSSPAEGRTDLSERPMNRRLTQSLHQVYRIQQVHRTHPAPRHRPARRPS
DWDPTNSTAWMVNEAWRRFPMKRCQNSIMGPLPSDWWEGYFKRSIWSLRHPRAIWSPVTI
KIVPPARTVPPSASPAEVINSAGLSPSERLPDPCAKETVLRALKECKKGKVRFEEPLFHE
SFDCKRSIPETRLSAFKPLVKEGVLTSFVPRPGPLNRSLNPWSSDHSLNKRPGCSSMDSL
TSTHTGDSLNSKRNAISSSFSSSRDFSEPWKKSIPSASLQIPEWPVKKKEKGHQSHLPVP
LVSDESPETSGSSGQQNQVPLLPSSPENLLSLTPPPQLGHPVPEDLALWKKAGLQSSNKA
RENTTESTTDSVPESRSAIQPSLSLTLPSAGTAPTQSTDPQLESLNKLQKSPGPPDFPQP
TGEVISAAHSPLTTASLPAPFGCSQSDPLSGISSDSKLPATFIHLTPVSPTSPVTGTTQL
PLASQAAVHLDSSAIIPTAPATQSTSFRLMSSPGPHPPASVPPIAASADHMSKPILGLPP
NSETGTSLYSRISVTAAPSSAPGTLTPTFRPIFGSVRPLKTMPMIAPFSFKQASPPPTPA
SPHLFHGLVKATSVVMSTTPANTSKDSLTPPFDFGVVNVTSTMGNTYSIPSTCHTFLLGA
ACAFKGSFSPAAGFILPPCQRPTIPTVHTVTIFSQVLPSAVQISPTRSTANFRASSLSAS
ALGNTNQPAFSSRISSSTSAFTIPLGSGPRPPFSLSLGATPQPAFGIAYGQKQGAPQPAL
GPSFSSSLIFGNSTVAFSTPSQTLTQPSFNSPTQSAFGGLAPSASTFCIPTNLRPDVNNT
PVAFPFGQANTNGFGVVSPTHRTGACGSVFGSTAPRPFDFGGLVTPMDCGETGVSVTAPD
MSSNSRAFSTGAVPSGTTNTITPLGKGWGPKNQGLTSQGTPFALGRANISARKTMFRGPS
MDPFAQSTPVLAPVKAGSSFGFGMHSSPPQGSVGKGSFRSPASSFSIGTKSKTSRNREQG
HSRRHHSHKK
NT seq 3093 nt NT seq  +upstreamnt  +downstreamnt
atgggcagttacctgggcaagctgggactttcgccatcatccccagcagaagggcgcaca
gacttgtcggagaggccaatgaaccgccggctaactcagtcccttcatcaagtctaccgg
attcagcaagtccatcgtacccaccccgcccctcgacacagacctgcgagaaggccgtcg
gactgggatcctaccaactccaccgcgtggatggtcaatgaggcttggaggcgctttccc
atgaagagatgccagaattccatcatggggcctcttccctcagactggtgggaaggttac
ttcaagcggagtatctggtctctgcggcaccctagggcaatatggagcccggtgaccatc
aagatcgttcctcctgcgcggacagtgcccccctccgcttccccagcagaggtaatcaac
tctgcagggctctcgccctctgagaggctcccagacccctgtgcaaaggaaacggtgctg
agggccctcaaagagtgcaagaaggggaaagtgaggtttgaagaaccactgtttcatgag
agctttgactgtaagagaagtattccagagaccagactatctgcatttaaacctctggtt
aaagagggagtcctcacttcttttgtgcctaggccggggcctctgaatagaagcctcaac
ccttggagctcagatcacagcttgaataagaggcccggttgttcctccatggactccttg
accagcacacacacaggcgactcccttaactccaaaagaaatgctatctcaagctctttc
agctcttctcgagatttctcagaaccttggaagaaaagtattcccagtgcatcactccag
ataccagagtggccagtaaaaaagaaagaaaaaggtcatcagtctcaccttccagtcccg
ctggtatcagacgagtctccagaaacatctggcagctctggacagcaaaatcaggttcca
ctgcttccatctagccctgaaaacctgctgtctctcactccacctccccagcttggtcat
ccagtccctgaagacctggccttatggaagaaagctggactccaatcgagcaacaaagcc
agagagaatacaactgagagcaccacagactctgtccctgagtctaggtctgctattcag
ccttccctgtctctcaccctgccttctgcaggcacagctccaacccagagcactgatcct
cagttggaaagtttaaataagttacagaagtctccaggtccaccggacttcccacagccc
actggagaggtaatcagtgcagcccactcacctctgacaacagcaagcctgccagcccca
tttgggtgctcacagtcagaccccctttcaggcatctcttcggactcaaaactcccagct
actttcatccatctgacccctgtttctcccacatcaccagtcactggcaccacacagcta
cctttggcgtctcaggctgccgtgcacctagactcatctgctattatccctacagccccc
gctacgcaaagtacttcgtttagactgatgagcagcccaggtccccatcctcctgcatct
gtgcctcctattgcagcttctgctgaccacatgtcaaaacccattttagggctcccaccc
aatagtgagactgggacctccttatactctagaatttcagtcacagctgctccatcttca
gctccaggtaccttaactcccactttcaggcctatctttggcagtgtaagaccacttaaa
actatgcccatgatagctcctttctctttcaagcaggcctctcctccacctacccctgct
tctccccatctcttccatggcctggtcaaggctacctctgtagtcatgtccaccacacca
gccaacacatccaaagactctcttacgccacctttcgattttggtgtagtgaatgttacc
agtaccatgggcaacacttactccatcccttccacttgccacactttccttcttggggct
gcctgtgccttcaagggcagtttctccccagctgcaggcttcattttgccgccatgccaa
cgtcctaccatacctactgtacacacagtcactatctttagccaggttcttcccagtgct
gtccaaatatcccctaccaggagcactgccaattttagggctagctctctgtccgcttca
gccctaggaaacaccaaccagcctgcattttcatccaggatctccagttcaacctcagca
ttcacaattcccttggggtcaggcccaaggccacctttttcactatccctgggagcaact
ccccagcctgcatttggaattgcatatgggcagaagcaaggagccccccaaccagccctt
ggcccaagcttcagtagctctctcatttttggaaactcaacagtggcattctcaacccca
tcacaaactctgactcaaccatccttcaacagtcccactcagtcagcctttggaggtttg
gcaccatcagcctccaccttttgcatccctaccaacctccggccagatgttaacaacact
ccagtagcttttccctttggtcaggctaatacaaatggttttggagttgttagcccaacc
caccggactggggcttgtggctcagtgtttggtagcacagccccaagaccttttgacttt
gggggattagtaacccctatggactgtggtgagactggggtcagtgtgactgctccagac
atgagttccaactccagagcattcagcactggagcagtgccaagtgggacaactaacacc
atcacacccttgggtaaaggctggggcccaaaaaaccagggcctgaccagccagggcaca
ccttttgccttggggagggccaacatttctgcaagaaaaactatgtttaggggcccttcc
atggatccctttgctcagagcactcctgtccttgcaccagttaaggcaggcagcagtttt
ggctttgggatgcattcttcacctccccagggctctgttggaaaaggatctttcagatcg
ccagcctcatcattttccattggcacaaaatcaaaaacctcaagaaatagggagcaaggg
cattctcgaaggcatcattcccataagaaataa

DBGET integrated database retrieval system