KEGG   Bos taurus (cow): 100141158Help
Entry
100141158         CDS       T01008                                 

Gene name
USP48
Definition
ubiquitin specific peptidase 48
Orthology
K11858  
ubiquitin carboxyl-terminal hydrolase 48 [EC:3.1.2.15]
Organism
bta  Bos taurus (cow)
Brite
Enzymes [BR:bta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100141158 (USP48)
Peptidases [BR:bta01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100141158 (USP48)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 1036 aa AA seqDB search
MAPRLQLEKAAWRWAETVRPEEVSQEHIETAYRIWLEPCIRGVCRRNCKGNPNCLVGIGE
HIWLGEIDENSFHNIDDPNCERRKKNSFVGLTNLGATCYVNTFLQVWFLNLELRQALYLC
PSTCSDYMMGDGIQEEKDYEPQTICEHLQYLFALLQNSNRRYIDPSGFVKALGLDTGQQQ
DAQEFSKLFMSLLEDTLSKQKNPDVRNIVQQQFCGEYAYVTVCNQCGRESKLLSKFYELE
LNIQGHKQLTDCISEFLKEEKLEGDNRYFCENCQSKQNATRKIRLLSLPCTLNLQLMRFV
FDRQTGHKKKLNTYIGFSEILDMEPYVEHKGGSYVYELSAVLIHRGVSAYSGHYIAHVKD
PQSGEWYKFNDEDIEKMEGKKLQLGIEEDLAEPAKSQTRKPKCGRGAHCSRNAYMLVYRL
QTRERPGTPIQVPAFLQELVDRDNSKFEEWCVEMAEMRKQSVDKGKAKHEEVKELYQRLP
AGAEPYEFVSLEWLQKWLDESTPTKPIDNHACLCSHDKLHPDKISIMKRISEYAADIFYS
RYGGGPRLTVKALCKECVVERCRVLRLKNQLNEDYKTVNNLLKATVKSSDGFWVGKSSLR
SWRQLALEQLDEQDGDADQSNGKMNGNTLNKDESKEERKEDEEELNFNEDILCPHGELCI
SENERRLVSKEAWSKLQQYFPKAPEFPSYKECCSQCKILEREGEENEALHKMIANEQKTS
LPNLFQDKNRPCLSNWPEETDVLYIVSQFFVEEWRKFVRKPTRCSPVSSVGNSALLCPHG
GLMFTFASMTKEDSKLIALIWPSEWQMIQKLFVVDHVIKITRTEGGDAHPSETQYISEPK
LCPECREGLLCQQQRDLREYTQATIYVHKVVDNKKVMKDSAPELNVSSSETEEDKEEAKL
DGEKDPDFNQSNGGTKRQKISHQNYIAYQKQVIRRSMRHRKVRGEKALLVSANQTLKELK
IQIMHAFSVAPFDQNLSIDGKVLSDDCATLGTLGVIPESVILLKADEPIADYAAMDDVMQ
VCMPEEGFKGTGLLGH
NT seq 3111 nt NT seq  +upstreamnt  +downstreamnt
atggcaccgcggctgcagctggagaaggcggcctggcgctgggcggagacggtgcggccc
gaggaggtgtcgcaggagcacatcgagaccgcctaccgcatctggctggagccctgcatc
cgcggcgtgtgcagacgaaactgcaaaggaaatccaaattgcttggttgggattggtgaa
cacatttggttgggagaaatcgatgaaaatagttttcataacattgacgaccccaactgt
gagaggagaaaaaagaactcgtttgtgggcctcactaaccttggagccacttgttacgtc
aacacttttctccaagtgtggtttcttaacctggagcttcggcaggcgctctacttgtgt
ccaagcacctgtagtgactacatgatgggagacggcatccaagaagaaaaagattatgag
cctcaaacgatttgtgagcatctccagtacttatttgccttgttacaaaacagtaatagg
cgatacatcgatccatcaggatttgtgaaagccttgggcttagacacagggcaacagcag
gatgcccaagaattttcaaagctctttatgtctcttttggaagatactttgtctaaacaa
aagaatcccgatgtgaggaacattgtccaacagcagttctgtggggaatatgcttatgta
actgtctgcaaccagtgtggcagagaatctaagcttttatcaaaattttatgaactggag
ttaaatatccaaggccacaaacagttaacagattgtatctcggaatttttgaaggaagaa
aaattagaaggagacaatcgatacttttgtgaaaactgtcaaagcaagcagaacgcgaca
aggaagatccgactccttagtctcccttgtactctgaacttacagctgatgcgttttgtc
tttgacaggcaaactggacataagaaaaagctgaatacctacattggcttctcagaaatt
ttggatatggaaccgtatgtggaacacaaaggtgggtcctatgtgtatgaactcagcgcg
gtcctcatacacagaggagtgagtgcttattctggccactacattgcccacgtgaaggat
ccacagtctggcgaatggtataagtttaatgatgaagacatagaaaagatggaggggaag
aaattacaactagggattgaggaagatctagcagagcctgccaagtcccagacacggaag
cctaagtgtggcagaggagcccactgctcccggaacgcctacatgctggtttataggctg
cagacccgggaaaggcccggcacgcccattcaggtgccagcctttcttcaggagctggtg
gatcgagataattccaaatttgaggagtggtgtgtggaaatggccgagatgcgtaagcag
agtgtggataaaggaaaagccaagcacgaagaagttaaggagctgtaccaaaggttacct
gctggagctgagccctatgaattcgtctctctcgagtggctgcagaagtggttggatgag
tcaacacctaccaaacctattgataatcatgcttgcctgtgttcccacgacaagcttcat
cctgataaaatatcgattatgaagagaatatctgaatatgcggctgacattttctacagt
agatatggaggaggaccaagactaactgtgaaagccctgtgtaaggagtgtgtagtagaa
cgttgccgtgtgctgcgtctgaagaaccaactaaacgaagattataaaactgtaaataat
ctgcttaaagcaacagtgaagagcagtgatggattttgggtggggaagtcctccttacgc
agttggcgccagctggctcttgaacagcttgatgagcaagatggcgatgcagaccaaagc
aacgggaaaatgaatggcaacaccttgaataaagatgaatcaaaggaagaaagaaaggag
gacgaggaggaattgaatttcaatgaagacattctgtgcccacatggcgagttatgcata
tcagaaaatgaaagaaggcttgtttctaaagaggcttggagcaaactgcagcagtacttt
ccaaaggctcccgaatttccaagttacaaagagtgctgttcgcagtgcaagattttagaa
agagaaggggaagaaaatgaagccttacataagatgattgcaaatgagcagaaaacttct
cttccaaatttgttccaggacaaaaacagaccgtgtctcagtaactggccagaggaaaca
gatgtgctctacattgtgtcccagttctttgtagaagagtggcgaaaatttgtcaggaaa
cctaccaggtgcagtcctgtgtcatcggtcggaaacagcgctctcctgtgtccccacggg
ggcctcatgtttacatttgcttccatgaccaaagaagattctaaacttatagctctcata
tggcccagtgagtggcagatgatacaaaagctctttgttgtggatcatgtaattaaaatc
acgagaactgaaggaggagatgcacacccttcagaaacacagtatatttctgagcctaaa
ctctgtccagaatgtcgagaaggcttattgtgtcaacagcagagggacctgcgtgaatac
actcaagctaccatctatgtccataaagttgtggataataagaaggtgatgaaggattca
gctccagagctaaatgtgagtagttctgaaacagaggaggataaggaagaagctaaactg
gatggagaaaaagatccagactttaatcaaagcaatggaggaacaaagcggcaaaagatc
tcccatcaaaattatatagcctatcagaagcaagttattcggcggagtatgcgacacaga
aaagttcgtggtgaaaaagctcttctcgtttctgctaatcaaacattgaaagaattgaaa
atccagatcatgcatgcgttttcagttgctccttttgaccagaacctgtcaatcgatgga
aaggttttaagtgatgactgtgccaccctcggaaccctaggcgtcattcctgaatctgtg
attctgttaaaggctgatgaaccaattgcagattatgctgcaatggacgatgtcatgcaa
gtgtgtatgccagaagaagggtttaaaggtactggtctacttggacattaa

DBGET integrated database retrieval system