KEGG   Bos taurus (cow): 100141289Help
Entry
100141289         CDS       T01008                                 

Gene name
USP13
Definition
ubiquitin specific peptidase 13 (isopeptidase T-3) (EC:3.4.19.12)
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.4.19.12]
Organism
bta  Bos taurus (cow)
Brite
Enzymes [BR:bta01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100141289 (USP13)
Peptidases [BR:bta01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100141289 (USP13)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100141289 (USP13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
1
AA seq 863 aa AA seqDB search
MQRRGALFGMPGGSGSRKMAAGDIGELLVPHMPTIRVPRSGDRVYKNECAFSYDSPNSEG
GLYVCMNTFLAFGREHVERHFRKTGQSVYMHLKRHVREKVRGASGGALPKRRNSKMFLDL
DTDDDLNSDDYEYEDEAKLVIFPDHYEIALPNIEELPALVTIACDAVLSSKSPYRKQDPD
TWENELPVSKYANNLTQLDNGVRIPPSGWKCARCDLRENLWLNLTDGSVLCGKWFFDSSG
GNGHALEHYRDTGYPLAVKLGTITPDGADVYSFQEEEAVLDPHLAKHLAHFGIDMLHMHG
TENGLQDNDIKPRVSEWEVIQETGTKLKPMYGPGYTGLKNLGNSCYLSSVMQAIFSIPEF
QRAYVGNLPRIFDYSPLDPTQDFNTQMTKLGHGLLSGQYSKPPVKSELIEQVMKEEHKPQ
QNGISPRMFKAFVSKSHPEFSSNRQQDAQEFFLHLVNLVERNRIGSENPSDVFRFLVEER
IQCCQTRKVRYTERVDYLMQLPVAMEAATNKDELIAYELTRREAESNRRPLPELVRAKIP
FSACLQAFSEPENVDDFWSSALQAKSAGVKTSRFASFPEYLVVQIKKFTFGLDWVPKKFD
VSVDMPDLLDINHLRARGLQPGEEELPDISPPIVIPDDSKDRLMTQLIDPSDIDESSVMQ
LAEMGFPLEACRKAVYFTGNMGAEVAFNWIVVHMEEPDFAEPLTMPGYGGAASAGASVFG
ATGLDNQPPEETVAIITSMGFHRNQAIQALRATNSNLERALDWIFSHPEFEEDSDFVIEM
ENNANANIVSEAKPEGPRVKDGSGMYELFAFISHMGTSTMSGHYVCHIKKEGRWVIYNDH
KVCASERPPKDLGYMYFYRRIPS
NT seq 2592 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgccggggcgccctgttcggcatgccgggcggtagcggcagcaggaagatggct
gcaggagacatcggcgagctgctagtgccccacatgcccacgatccgcgtgcccaggtcc
ggggacagggtctacaagaacgagtgcgccttctcctacgactccccgaattctgaaggc
ggactctatgtctgcatgaatacatttttggcctttggaagggaacacgtggaaagacac
tttcgaaaaactggacagagtgtctacatgcatctgaagagacacgtgcgcgagaaggta
agaggcgcatctggtggcgctttacccaaaaggaggaattccaagatgtttttagatcta
gatactgatgacgatttaaatagcgacgattatgaatatgaagatgaagccaaacttgtt
atattcccagaccactatgaaatagccctaccaaatattgaggagttaccagccctggta
accattgcttgtgatgcagttctcagctcaaaatctccatacagaaagcaggacccagat
acatgggagaatgaattgccagtgtcgaaatatgccaataaccttacccagttggacaat
ggagtcagaattcctccaagtggttggaagtgtgccaggtgcgaccttcgggagaacctc
tggttgaacctgaccgatggctccgtgctgtgtgggaagtggttctttgacagctctggg
ggcaacgggcatgcgttggagcattacagagacacaggctaccctctcgctgtgaaactg
gggaccatcactccggatggggccgatgtttattctttccaagaagaggaagctgttttg
gaccctcatttggccaagcacttagcacattttggaattgacatgcttcatatgcatggg
acagagaatgggctccaggacaacgacatcaagccgcgggtcagcgagtgggaggtgatc
caggagacggggacaaagctgaagcccatgtacggcccagggtacacagggctcaagaac
ctgggcaatagctgctatctcagctctgtgatgcaggccatcttcagcatcccagaattc
cagagagcgtatgtaggaaatcttccaagaatatttgactactctcctttagatccaaca
caagatttcaacacacagatgactaagttaggacatggccttctctcaggccagtattca
aaacctcccgtgaagtctgagctcattgaacaggtgatgaaggaggaacacaagcctcaa
cagaatgggatctctccacgcatgtttaaggcctttgtgagcaagagccacccggaattc
tcctccaacagacagcaggatgcccaggagtttttcctgcacctggtgaatctagtagag
aggaaccgcattggctcagaaaacccaagtgatgtttttcggtttttggtggaagagcgg
attcagtgctgtcagacccgaaaagtccgctacacggagagggtggactacctgatgcag
ttacctgtggccatggaggcagcaaccaacaaagatgaactgatcgcctatgaactaacg
agaagggaagcagaatcaaacagaagaccccttcccgagttggttcgtgccaagatacca
ttcagtgcctgcctgcaggccttttctgaaccagaaaatgttgatgatttctggagcagc
gccttgcaagcaaagtctgcgggtgtgaaaacatctcgctttgcctcattccctgaatac
ttggtagtgcagataaagaagttcacttttggtcttgactgggttcccaaaaaatttgat
gtttctgttgatatgccagacctacttgatatcaaccatctccgagccagggggttgcag
ccaggagaggaggaacttccagacatcagcccccccatagtgattcctgatgactctaaa
gatcgcctgatgacccaattgatagacccatcagatattgatgagtcttcggtgatgcag
ctggctgagatgggcttccctctagaagcatgtcggaaggctgtgtattttactggaaat
atgggagccgaggtggccttcaactggatcgttgttcacatggaagagccagattttgct
gaaccgctgaccatgcctggttatggaggagcagcttctgctggggcctctgtttttggt
gctactggattggataaccaacctccggaagaaactgtagctatcattacctccatggga
ttccatcgaaatcaggctattcaggccctgcgagcaacgaatagtaacctggaaagagca
ctggattggatctttagccaccctgagtttgaggaggacagtgactttgtgatcgagatg
gagaataacgccaatgcgaacatcgtttctgaggccaaacctgaaggacctagagtcaag
gatggatctggaatgtatgaattatttgcgttcatcagtcacatgggaacgtctacaatg
agtggccactacgtttgtcacattaaaaaggaaggaagatgggtgatctacaatgaccac
aaagtttgtgcctcagaaaggccccctaaagacctgggctacatgtacttttaccgcagg
ataccaagctaa

DBGET integrated database retrieval system