KEGG   Bos taurus (cow): 100295732Help
Entry
100295732         CDS       T01008                                 

Gene name
MAP2K5
Definition
mitogen-activated protein kinase kinase 5 (EC:2.7.12.2)
Orthology
K04463  
mitogen-activated protein kinase kinase 5 [EC:2.7.12.2]
Organism
bta  Bos taurus (cow)
Pathway
MAPK signaling pathway
Gap junction
Neurotrophin signaling pathway
Oxytocin signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:bta04010]
Cellular Processes; Cell communication; Gap junction [PATH:bta04540]
Organismal Systems; Endocrine system; Oxytocin signaling pathway [PATH:bta04921]
Organismal Systems; Nervous system; Neurotrophin signaling pathway [PATH:bta04722]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
10
AA seq 448 aa AA seqDB search
MLWLLLGPFHAMENQVLVIRIKIPNSGAVDWTVHSGPQLLFRDVLDVIGQVLPEATTTAF
EYEDEDGDRITVRSDEEMKAMLSYYYSTIMEQQVNGQLIEPLQIFPRACKPPGERNIHGL
KVNTRAGPSQHSSPAVSDSLPSNSLKKSSAELKKILANGQMNEQDIRYRDTLGHGNGGTV
YKAYHVPSGKILAVKVILLDITLELQKQIMSELEILYKCDSSYIIGFYGAFFVENRISIC
TEFMDGGSLDVYRKIPEHVLGRIAVAVVKGLTYLWSLKILHRDVKPSNMLVNTRGQVKLC
DFGVSTQLVNSIAKTYVGTNAYMAPERISGEQYGIHSDVWSLGISFMELALGRFPYPQIQ
KNQGSLMPLQLLQCIVDEDSPVLPVGEFSEPFVHFITQCMRKQPKERPAPEELMGHPFIV
QFNDGNATVVSMWVCRALEERRSQQGPP
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgctgtggctgctccttggccccttccatgccatggagaaccaagtgctggtgattcgc
atcaagattcccaatagtggagcagtggactggacagtgcactctgggccgcagctactc
ttcagggatgtgctggatgtgataggccaggttctgcctgaagcaacaaccacagcattt
gaatacgaagatgaagatggtgatcgaattacagtgagaagtgatgaagaaatgaaggca
atgctgtcatattattattctacaataatggaacagcaagtaaatggacagttaatagag
cctctgcagatatttccaagagcctgcaagcctcctggggaacggaacatacatggcctg
aaggtgaatacccgggctggaccctctcaacacagcagcccagccgtctcagattcactt
ccaagcaatagcttaaagaagtcttctgccgaactgaaaaaaatattagccaatggccag
atgaatgaacaagacatacggtatcgagacactcttggtcatggcaacggcggcacagtc
tacaaagcatatcatgtcccaagtgggaaaatactagctgtaaaggtcatactactagat
attacactggaacttcagaagcaaattatgtctgaattggaaattctttataagtgtgat
tcatcatatatcataggcttttatggtgcatttttcgtggagaacaggatttcaatatgt
actgaatttatggatggaggctctttggatgtatatagaaaaattccagagcatgtcctt
ggaagaattgcagtggcggttgttaaaggccttacttatttgtggagtttaaagatttta
catagagatgtgaagccctccaatatgctagtaaacacaagaggacaagtcaagctgtgt
gattttggagttagcactcagctggtgaattctatagccaagacgtatgttggaacaaat
gcttatatggcgcctgaaagaatttcaggggagcagtatggaattcattctgatgtctgg
agcttaggaatctctttcatggagcttgctcttgggaggtttccatatcctcagattcag
aaaaaccagggatctttaatgcctctccagcttctgcagtgcattgttgatgaggattcg
cccgtccttccggttggagagttctccgagccatttgtacatttcatcactcagtgcatg
cgaaagcagccaaaagaaaggccggcacctgaggaactgatgggccacccattcatcgtg
cagttcaatgacggaaacgccaccgtggtgtccatgtgggtgtgcagggcgctggaggag
aggcgaagccagcagggccccccctga

DBGET integrated database retrieval system