KEGG   Bos taurus (cow): 100296901Help
Entry
100296901         CDS       T01008                                 

Definition
maltase-glucoamylase, intestinal-like
Orthology
K12047  
maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
bta  Bos taurus (cow)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Carbohydrate digestion and absorption
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bta00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bta00500]
Organismal Systems; Digestive system; Carbohydrate digestion and absorption [PATH:bta04973]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 2477 aa AA seqDB search
MARKLSALEILLIIFIIIVLAVDILFLMLLLEKPSGASFVPECPEIPESERIDCAPGQEV
TEDVCRQRYKCCWKPVPDTAIPWCFFPRNWGYEISNLVKNTSTEYEAQLRRLPSPSLFGY
DVIDTLFRAEYQTSNRFHFKITDFNNMRYEVPHENVKLFDGNADASNLSYHLEVIHKPFS
IKIMRASNKRVLLDTSIGPLQFAQQYLQLSMRLPSANVYGLGEHVHQQYRHNMTXKNWPI
FTRDATPTEGMINLYGAHTFFLCLEDTSGFSFGVFLMNSNAMEVTLQPAPAVTYRTIGGI
LDFYVFLGNTPEQVVQEYLELVGRPFLPPYWSLGFQLSRRNYGGIDGLKNVVNRTREAEI
PYDVQYSDIDYMDEKKDFTIDGVAFRGLSGFAEELHKNGLKYVIIMNPGILNNSDYQPYA
NGSRKRVWILGDKGFVVGQAYPGWTVFPDFTNPDCTEWWKEQFSEFYKTLEFDGVWIEMD
EVSSFLQSSDQDCEVNNFNFPPFKPRVLDHLLFARTLCMDTEFHGGFHYDVHSLYGYTMA
KATDSAMENIFRNKRRFILSRSTFAGSGKFAAHWLGDNAARWDDLRWSIPGILEFNLFGI
PMVGANICGYRENVTEELCRRWMQLGAFYPLSRNHNGPGFRDQDPAAFSENNAMLLESSR
YYLNIRYTLLPYLYTLFYRAHTLGETVARPLVHEFYQDPATWEVHEQFLWGPGLLITPVL
YEGLNYARAYIPDAIWYDYETQVAIEWRKQFVEMLLPGDRIGLHLRGGYIFPIQQPNTTT
ETSRKNSLGLIIALDSKREAKGELYWDDGVSKDAVTGNNYILYKFSITSNRLQATIIHAN
YTDPDKLTFTDIMILGMDKEPTNFTVSLNDVTTSISNVVYTESTKVVNITDLEGLVLGQA
FSIQWDLPVSDLQKFNCFPEQPAVSEESCRERGCLWEPTTVPGVPTCFYDTIPNYAASNI
QYLPTGITVDLTHLTASEAGQAMVPAPSSQDKLSPPAAAAKAASASDTLSATIGFLRLSV
TYHTENMLQFKIYDPTNKRYEVPVPLNTPSSPVGSPENCLYDVKIQNNPFGIQIRRKSSS
TVIWDSQLPGFTFRDMFLSISTRLPSQYLYGFGETEHTTFRRNISWHTWGMFARDEPPAY
KKNSYGVHPYYMALEEDGSAHGVLLLNSNAMDVTFQPTPALTYRTTGGILDFYMVLGPTP
ELVTQQYTELIGRPAMIPYWALGFQLSRYGYQDDYEISSLYVAMMAAQIPYDVQHVDIDY
MDRKLDFTLSPSFQNLGPLIEQMKKNGTRFVLVLDPAISGNETQYLTFTRGKESDVFIKW
PDNSDIVWGKVWPDLPNVNVDGSLDHETQVKLYKAHVAFPDFLRNSTAAWWKREIEELYR
NPREPEKSLKFDGLWINMNEPSNFVNGSVRGCSDEILNNPPYVPYLESRDRGLSSRTLCM
ESQQVLPDGSPVRHYDVHSLYGWAQTRPTYEAVQEVTGQRGIVITRSTFPSSGRWGGHWL
GDNRAAWDQLKKSIIGMMEFSLFGISYTGADICGFFGDAEYEMCVRWMQLGAFYPFSRNH
NTFGTRRQDPVAWDSAFEMFSRKVLQTRYTLLPYLYTLMHKAHAEGSTVVRPLLHEFTEE
RTTWDIDHQFMLGPAVLISPVLENNTFQVQAYFPRARWYDYSTGSGNESTGEWKVLEAPL
DHINLHIRGGYILPWQEPAMNTYSSRQKYMGLIVALDDNGRAEGQLFWDDGQSIDTFENG
NYFLVNFTAAQSVLQIQMIHNNYLSDTNSLKVGYIRIWGINSTDITQVTVSYDNQQFMVM
NFKSDPYNQTLNIQLTDKIISLEKLTEITWIHSGPIVSTTTMTSTFPMSSLHPPTTSTTA
ATSVTTSSSTPSSTSTTDSSSAALPMTTTSFPTSATEVSTGTTVPNTSTSFPTNTATDST
SVILPITTMHYPTSATEVSTSVTVPNTTISSPIHTTLDSTDSTLPITDTPYTTSATQVLT
STTVPNATVSSPINTTTDTTDITLTITDTPSTTSATQVSTSTTVPNATISSPINTTTHST
NVTLPVTTTPYITTTAEVSTSTTVPNATISSPINTTTDNTNVTLPVTTMSYITTTAEVST
STTVPNATVSSPINTTADSTNVTLPVTTMAYTTSTAEVSTTTTFLNATISSPIYTTLDST
NVTLHITDTPYTTSATQVSTSTTVPNATISSPINTTTDSTILTLSVTTMLYPTSATEVST
STTFPNATISSPINTTTDTTDITLPITDTPYTTSATQVSTSTTVPNATISSPINTTTDGT
NVTLPVTDMLYTTSASQVSTSTTVPDATISSPINTTTDTTDITLPITDTPYTTTASQVST
STTVPNATISSPINTTTDTTDITLPITDTPYTTTASQVSTSTTVPNATISSPINTTTGTT
DITFPITDTPYTTTASQVSTSTTVPNATISSPINTTTDSTNVTLPVTTMPFPKSSTEVST
STAVSNTTVSSPTNSTV
NT seq 7434 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggaagcttagtgcattggaaatcctcctgatcatcttcatcataattgtactt
gctgtagatatcctctttctgatgcttctgttggagaagccttcaggtgcttcatttgtt
ccagagtgcccagaaatccccgaatcagaaaggatagactgtgcccctggccaggaggtg
acagaggatgtctgccgacagagatataagtgctgctggaaacctgtgccagatactgcc
atcccctggtgcttcttccccaggaactggggctacgaaatcagcaatttggttaaaaat
acaagcacagagtatgaggcccagttgagaaggctgccatcaccatctctgtttggatat
gatgtaatcgacaccctcttcagagctgaatatcagacatccaatcgtttccattttaag
atcactgatttcaataacatgcgctatgaagtcccccatgaaaatgttaagctctttgat
gggaatgctgatgcttccaatttgagctatcatctagaagtcattcacaaacccttcagc
atcaagataatgagggccagcaacaaaagagtcttgttggacaccagcattgggcccctc
cagtttgcccagcagtacctgcagctctccatgcgactgcccagtgccaatgtgtacggg
ctgggcgaacacgtgcaccagcagtaccgccacaacatgacctgnaagaactggcccatc
ttcacccgggacgccacccctaccgagggcatgattaatctatatggagctcacacattc
ttcttgtgcctagaagacaccagcggcttctctttcggggtttttctgatgaacagtaac
gccatggaggtcacccttcagcccgctcctgccgtcacttaccgcacgatcgggggtatt
cttgacttctatgtgttcctgggaaatactccagaacaagtggttcaggaatatctggag
cttgttggacgaccattcttgcctccctactggagtcttgggttccagcttagtcgcagg
aattatggtggtattgatggattgaaaaatgttgtaaaccgaactcgtgaagctgagatc
ccttatgatgtccagtactctgacatagactacatggatgaaaagaaggatttcactatt
gatggagtggccttccgtggtctctcaggttttgccgaagagttacataaaaatggactg
aaatatgtaattattatgaatcctggcatcttaaataactctgactaccagccttatgcg
aatggaagcagaaagagagtgtggatcttgggggacaaaggctttgttgttgggcaggca
tatcctggctggacagtttttcctgattttactaatccagattgtactgagtggtggaaa
gagcagttcagtgaattttataaaactctggagtttgatggagtgtggattgaaatggat
gaagtatctagctttctacaaagttctgatcaagactgtgaagtaaacaacttcaacttt
cctcctttcaaacctcgagttctggatcacttgcttttcgcaagaaccctctgcatggac
acagagtttcatgggggctttcactacgatgtccacagcttgtatggctacaccatggca
aaagccacagactcggccatggagaatatcttccgcaataagagacgcttcatcttatca
cgttctacttttgcgggatctggcaaatttgctgctcattggttgggggacaatgcagcc
agatgggacgatctccgatggtccatccctggtatcctggagttcaacctattcggcatc
cccatggtaggtgccaacatctgtggttacagagagaatgtcacagaggagctttgcaga
cggtggatgcagctgggagcattttatccactgtcgaggaatcacaacgggcctgggttc
agggaccaggatcctgctgccttcagtgaaaacaacgctatgctgttggaatcctccaga
tactatctgaacatccgctacaccctgctgccctatctctacacccttttctaccgagct
cataccctgggggagaccgtagcaaggcccctcgtccacgagttctaccaggacccagcc
acctgggaggtgcacgagcagttcctctgggggcctggactcctcatcacgcctgtttta
tatgaaggtttgaactatgcaagagcatacatacccgacgccatctggtacgactatgaa
acgcaagtagctatagaatggaggaaacaatttgtggagatgctgctgccaggtgatagg
ataggacttcacctccgagggggctacatctttcccatccagcagccaaacacgaccaca
gagaccagccggaagaactctctgggactcatcattgccttggactctaagcgagaagca
aagggagagctgtactgggatgatggtgtctctaaagatgctgtaactggaaataattat
attctgtataagttttccatcacctctaaccgtctacaggcaacgattatacatgctaat
tatacagaccctgacaaactcacatttacagatatcatgatcttgggaatggacaaggaa
cctactaattttactgtctccctaaatgatgtgaccacctccatttcaaatgttgtctac
acagaatcaacaaaggtggtgaacatcactgaccttgagggactggtactgggacaagca
ttctccattcagtgggatcttccagtcagtgacctgcagaagttcaactgctttcctgag
cagcctgctgtctccgaggagagttgcagggagcgggggtgcctttgggagccaacgact
gttcctggggtgcccacctgtttctatgacaccatccctaattatgctgccagcaacatt
cagtacctgcctacgggcatcactgtagacctcacccacctgacagcctcagaagctgga
caagctatggtgccagcaccatcatcacaggacaagctatccccacctgcagccgcagcg
aaggccgcctctgcctctgacactctctctgcaaccatcggctttctccgcctgagcgtg
acctaccacacagagaacatgctgcagttcaagatctatgatcccactaataaaaggtac
gaggtcccagtgcctctgaacaccccttcgtctccagtgggctcccctgaaaactgtctg
tatgatgtcaagattcagaacaatccttttgggatccagattcgaagaaagagctccagc
actgtgatttgggactctcagctccctggcttcaccttcagggacatgttcctttccatc
tccacacgcctcccctctcagtacctctatggctttggggaaactgagcacacaactttc
agaagaaacataagctggcacacgtggggaatgtttgcccgagatgagccaccagcgtat
aagaagaactcctatggtgtccacccctactatatggcactggaggaggatggcagtgcc
catggagtgctcctgctgaacagcaatgccatggatgtgacattccagcctactcctgcc
ctgacataccgcaccacaggaggcattttggacttttatatggttttggggccaacccct
gagcttgtaactcaacaatacactgagttgattggtcggccagcaatgattccttactgg
gccttgggattccaactgagtcgctatggataccaggatgattatgaaatctccagtttg
tatgttgcaatgatggctgctcagattccctacgatgtccagcatgtcgacatcgactac
atggaccggaagctggacttcactctcagccccagctttcaaaatcttggccccctgatt
gagcaaatgaagaaaaatggcacaagatttgttcttgttctggacccagccatttctggc
aatgagacccagtatctcacattcaccagagggaaggaaagtgatgtgttcatcaaatgg
ccagacaacagcgatattgtctggggaaaggtttggccagatctgcccaacgtgaatgtg
gatgggtcccttgatcacgaaactcaggttaagttgtacaaagcccacgttgcttttcct
gacttcttgcggaacagcactgctgcctggtggaagagggaaatagaagagctctacaga
aaccctcgagagccagagaagagcttgaagtttgatggattgtggattaacatgaatgaa
ccatcgaactttgtaaatggatctgtcaggggctgcagtgatgaaattcttaataatcca
ccctatgtgccatacttggagtcccgggaccggggcctgagcagcaggaccctgtgcatg
gagagccagcaggtgctgcccgatggctcaccggtgcgccactacgatgtgcacagcctt
tatggctgggcccagaccagacccacgtacgaagctgtgcaggaggtgacgggacagcga
gggatcgtcatcactcgctccactttcccctcttctggccgctggggaggacactggctg
ggtgacaacagggccgcgtgggaccagctgaagaagtcaatcattggcatgatggaattc
agtctctttggaatctcttatacaggagcagacatctgtggattctttggagatgctgag
tatgagatgtgtgttcgctggatgcagctgggggcgttttatccattttccaggaaccac
aacacattcgggaccaggagacaagatcctgtggcctgggactcagcctttgagatgttc
tcaagaaaagtcctccagaccagatatactctgctgccttacctctatactctgatgcat
aaggctcacgctgagggcagcactgtggtccgaccccttctccatgagtttacagaggag
cgcacaacatgggatatagaccatcagttcatgctgggccctgccgtcttaattagcccc
gtgctggaaaataacacttttcaggtccaggcttactttcccagagcccgttggtatgac
tacagcacgggatctggcaatgaatcaacaggtgagtggaaagtcctggaggctcccctg
gaccatatcaaccttcatatcagaggaggctacatcctgccttggcaagaacctgcgatg
aacacttactccagccgacagaaatatatgggattgattgttgctttggatgataatggg
agagctgaaggtcagctgttctgggatgatggacaaagcattgatacctttgaaaatgga
aactatttcttggtaaactttacagcagctcagagtgtactgcaaatccaaatgatacat
aataattatttgagtgacactaattcactgaaagttggatatattagaatctggggcata
aactctactgatataacacaagtgactgtctcctatgacaatcaacaattcatggtgatg
aatttcaagagtgacccttacaatcagacactaaatattcaactgactgacaagattatc
agcctggaaaagttaactgagattacttggattcacagtggtcctatagtttctactaca
actatgacgagtaccttcccaatgagttctttacatcctcctacaacttctactactgct
gctacttctgttaccactagttcttctactccaagtagcactagtactactgatagcagt
agtgctgctcttcctatgacaaccacttcttttccaacaagtgccactgaggtttcaact
ggtactaccgttcccaataccagtacatctttccctacaaatactgctactgatagcact
agtgttattcttcccatcacaaccatgcattacccgacaagtgctactgaagtttcaact
agtgttactgtccctaataccactatatcttcacctatacatacgactctggatagcact
gatagtactcttcctatcacagacacgccatacacaacaagtgctactcaagttttaact
agtactactgtccctaatgccactgtatcttcccctataaatactactactgataccact
gatattactcttactatcacagacacgccatccacaacaagtgctactcaagtttcaact
agtactactgtccctaatgccactatatcttcccctataaatactactactcatagcact
aatgttactcttccagtcacaaccacgccttacataacaactactgctgaagtttcaacc
agtactactgtccctaatgccactatatcttcccctataaatactactactgataacact
aatgttactcttccagtcacaaccatgtcttacataacaactactgctgaagtttcaact
agtactactgtccctaatgccactgtatcttcccctataaatactactgctgatagcact
aatgttactcttccagtcacaaccatggcttatacaacaagtactgctgaagtttcaact
actactactttccttaatgccactatatcttctcctatttatactactctggatagcact
aatgttactcttcatatcacggacaccccatacacaacaagtgctactcaagtttcaact
agtactactgtccctaatgccactatatcttcccctattaatactacgaccgatagcact
attcttactctttctgtcacaaccatgctttacccaacaagtgctactgaagtttcaact
agtactactttccctaatgccactatatcttcccctataaatactactactgataccact
gatattactcttcctatcacagacaccccatacacaacaagtgctactcaagtttcaact
agtactactgtccctaatgccactatatcttcccctataaatactactactgatggcact
aatgttactcttccagtcacagacatgctatacacaacaagtgcttctcaagtttcaaca
agtactactgtccctgatgccactatatcttcccctataaatactactactgataccact
gatattactcttcctatcacggacacgccatacacaacaactgcttctcaagtttcaaca
agtactactgtccctaatgccactatatcttcccctataaatactactactgataccact
gatattactcttcctatcacggacacgccatacacaacaactgcttctcaagtttcaaca
agtactactgtccctaatgccactatatcttcccctataaatactactactggtaccact
gatattacttttcctatcacagacacgccatacacaacaactgcttctcaagtttcaaca
agtactactgtccctaatgccactatatcttcccctataaatactactactgatagcact
aatgttactcttccggtcacaaccatgcctttcccaaaaagtagtactgaagtttcaact
agtactgctgtctctaatactactgtatcttcccctacaaacagtactgtctag

DBGET integrated database retrieval system