KEGG   Bos taurus (cow): 100300400Help
Entry
100300400         CDS       T01008                                 

Gene name
CLOCK
Definition
clock homolog (mouse) (EC:2.3.1.48)
Orthology
K02223  
circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
bta  Bos taurus (cow)
Pathway
Circadian rhythm
Dopaminergic synapse
Herpes simplex infection
Class
Organismal Systems; Nervous system; Dopaminergic synapse [PATH:bta04728]
Organismal Systems; Environmental adaptation; Circadian rhythm [PATH:bta04710]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:bta05168]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 845 aa AA seqDB search
MLFTVSCSKMSSLVDRDDGSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSM
LPGNARKMDKSTVLQKSIDFLRKHKEITAQSDASEIRQDWKPTFLSNEEFTQLMLEALDG
FFLAIMTDGSIIYVSESVTSLLEHLPSDLVDQSIFNFIPEGEHSEVYKILSTHLLESDSL
TPEYLKSKNQLEFCCHMLRGTIDPKEPSTYEYVKFIGNFKSLNSVSTSAHNGFEGTIQRT
HRPSYEDRVCFVATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYL
PFEVLGTSGYDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYH
QWNSRPEFIVCTHTVVSYAEVRAERRRELGIEESLPETAADKSQDSGSDNRINTVSLKEA
LERFDHSPTPSASSRSSRKSSHTAVSDPSSTPTKIPTDTSTPPRQHLPAHEKMAQRRSSF
SSQSINSQTVGQSLTQPVMSQSANLPVPHGMSQFQFSAQLGAMQHLKDQLEQRTRMIEAN
IHRQQEELRKIQEQLQMVHGQGLQMFLQQSTPGLNFGSVQLSSGNSSNIQQLAPINMQSQ
VVQTNQIQSGMNTGHIGTTQHMIQQQTLQSTSSQQSQQNVLSGHSQQTSLPSQTQSTLTA
PLYNTMVISQPAAGSMVQIPSSLPQNSSQSAAVTTFTQDRQIRFSQGQQLVTKLVTAPVA
CGAVMVPSAMLMGQVVTAYPTFAPQQPQSQTLSVTQQQQSSQEQPLPSVQQPSQAQLTQP
PQQFLQTSRLLHGNPSTQLILSAAFPLQQSTFPQSHHQQHQSQQQQQLSRHRTESLTDPS
KVQPQ
NT seq 2538 nt NT seq  +upstreamnt  +downstreamnt
atgttgtttaccgtaagctgtagtaaaatgagctcacttgttgacagagatgatggtagt
atttttgatgggttggtggaagaagatgacaaggacaaagcaaaaagagtatctagaaac
aaatctgaaaagaaacgtagagatcagtttaatgttctcattaaagaactgggatccatg
cttcctggtaatgctagaaagatggacaaatctactgttctacagaagagcatcgatttt
ttacgaaaacataaagaaatcactgcacagtcagacgctagtgaaattcgacaggactgg
aaacctacattccttagtaatgaagagtttacacaattaatgctagaggctcttgatggt
ttttttttagcaatcatgacagatggaagcataatatatgtgtctgagagtgtaacttca
ttgcttgaacatttaccgtcagatcttgtggatcaaagtatatttaattttatcccagag
ggggaacattcagaagtttataaaatactctctacccatctgctggaaagtgattcatta
acccctgaatatttaaaatcaaaaaatcagttagaattttgttgtcatatgcttcgagga
acaatagacccaaaggaaccatctacttatgaatatgtgaaatttataggaaatttcaaa
tctttaaacagtgtatccacttcagcacacaatggttttgaaggaacaatacaacgcact
cacaggccttcttatgaagatagagtttgttttgtagctactgtcagattagctacacct
cagttcattaaggaaatgtgcactgttgaagaacccaatgaagagtttacatctagacat
agtttagagtggaagtttctatttctagatcacagggcaccacccataataggatatttg
ccatttgaagttctgggaacatcaggctatgattactatcatgtggatgacctagaaaat
ttggcaaaatgtcatgagcacttaatgcaatatggaaaaggcaaatcttgttactatagg
ttcctgaccaaaggacagcagtggatttggcttcaaactcattattatatcacttaccat
cagtggaattcaaggccagagtttattgtttgtactcacaccgtagtaagttatgcagaa
gttagggctgaaagacgacgagaacttggcattgaagagtctcttccagagacagctgct
gacaaaagccaagattctgggtctgataatcgtataaatacagtcagtctcaaggaagcg
ttggaaaggtttgatcacagcccaactccttctgcttcctcccggagttcaagaaaatca
tctcacacagcagtctcggacccttcctctacaccaacaaagatcccaacagatactagc
actcctcccagacaacatttaccagctcatgagaagatggcacaaaggaggtcatcattt
agtagtcagtctataaattcccagactgttggtcagtcattaacacagcctgtgatgtct
cagtctgcaaatttaccagttccgcacggcatgtcccagtttcagttctcagctcagtta
ggagccatgcagcatctcaaagaccaattggagcaacggactcggatgatagaggcgaat
attcatcggcaacaagaagaactaagaaaaattcaagaacagcttcaaatggtccatggt
caagggctgcagatgtttttacaacagtcaacccctggattgaattttggttctgttcaa
ctttcttctggaaattcatctaatatccagcagcttgcacctataaatatgcaaagccag
gttgttcaaactaaccagattcaaagtggaatgaatactggacacattggcacaactcag
catatgatacaacagcagactttacaaagtacatcaagtcagcagagtcaacagaatgta
ctgagtgggcacagtcaacaaacatctcttcccagtcagacgcagagcactcttacagcc
ccactctacaacactatggtgatttctcagccggcggctggaagcatggtccagattcca
tcgagtttgccacaaaacagttcccagagtgctgcagtaactacattcactcaggacaga
cagatcagattttctcaaggtcagcaacttgtgaccaaattagtaaccgctcctgtagcc
tgtggggcggtcatggtacctagcgctatgcttatgggtcaggtagtgactgcctaccct
acctttgctccacaacaaccgcagtcgcagacactgtcagtcacgcagcagcagcagagt
tcccaggaacagccgctcccttcagttcagcaaccatctcaggctcagctgactcaacca
ccgcagcagtttctacagacttctaggttgctccatgggaacccttcaactcagcttatc
ctctctgctgcatttcctctacagcagagcactttccctcagtcacatcaccagcaacac
cagtcgcagcaacagcagcaactgagtcggcataggactgaaagtttgacggatccttcc
aaggttcaaccacagtag

DBGET integrated database retrieval system