KEGG   Bos taurus (cow): 100335534Help
Entry
100335534         CDS       T01008                                 

Gene name
HIST1H2BA
Definition
(RefSeq) histone cluster 1, H2ba
  KO
K11252  
histone H2B
Organism
bta  Bos taurus (cow)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:bta00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100335534 (HIST1H2BA)
  Immune diseases
   05322 Systemic lupus erythematosus
    100335534 (HIST1H2BA)
  Substance dependence
   05034 Alcoholism
    100335534 (HIST1H2BA)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100335534 (HIST1H2BA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
23
AA seq 127 aa AA seqDB search
MPELYSKGATISKKGFKKAVIKTQKKEGKKRRRCRKESYSIYIYKVLKQVHPDTGISSKA
MSIMNSFVTDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAV
TKYTSSK
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgccggagttgtattcaaagggtgctactatctccaaaaaagggttcaaaaaagctgtc
attaaaactcagaagaaagaagggaaaaagcgcaggagatgcagaaaagagagctattca
atatacatctacaaagtcttaaaacaagttcacccggataccggcatctcatcaaaagct
atgagcattatgaattcctttgtcactgacatctttgagcgtattgctggtgaggcgtcg
cgcctggcacattataacaagcgttcaaccatcacatccagagagatccagacagctgtg
cgcctgctgctgcctggggaattggctaagcacgccgtgtccgaaggtaccaaggctgtt
accaaatacaccagctccaaatga

DBGET integrated database retrieval system