KEGG   Bos taurus (cow): 100336575Help
Entry
100336575         CDS       T01008                                 

Gene name
MMP8
Definition
matrix metallopeptidase 8 (neutrophil collagenase)
Orthology
K01402  
matrix metalloproteinase-8 (neutrophil collagenase) [EC:3.4.24.34]
Organism
bta  Bos taurus (cow)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
15
AA seq 470 aa AA seqDB search
MFSLKMLPLLLLLHVQLSRAFPVSFASLEEKNRNIVQNYLEKFYQLPRFKYKSERKSKTN
VIVETLKRMQQFFGLNVTGKPNEETLEMMRKPRCGVPDSGSFMRTPGNPKWEKTKLTYRI
VNYTPNLTEMDVEAIIEEAFKVWSKVSPLTFNRTLDEEADIQISFAQRDHGDNSPFDGPD
GILAHAFQPGPGIGGDVHFDAEETWTKTSENYNLFPVAAHEFGHSLGLAHSSDPGALMYP
NYAFIDPSSYSLHQDDINGIQAIYGPSSNPVQPTGPTTPTACDPRLTFDAVTTLRGEILF
FKDKYVWRKHPRLRMAEFNFISLYWPSLPNGIHAAYEDFDRDLIFIFKGTQYWALSGYDT
QQGYPRHISSYGFPSSVQAIDAAVSYRRKTYFFVNDQFWSYDDQSQSMEPGYPQSIASFF
PGIESRVDAVFQENSLFLFFSGPRYYAFDFHARRVTRVDRSNTWLNCWYS
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgttcagcctgaagatgctcccacttctgctcttactccacgtgcagctttccagggcc
tttccagtatcttttgcatccctagaagagaaaaacagaaacattgttcagaattaccta
gagaagttctaccaattgccaaggttcaaatataagtctgaaaggaagagcaaaactaat
gtgattgttgagacacttaaaagaatgcagcaattcttcgggctgaacgtgacagggaag
ccaaatgaggaaaccctggagatgatgagaaagcctcgctgtggagtgcccgactcgggc
agctttatgagaaccccaggaaaccccaagtgggaaaaaactaagctgacctacaggatt
gtgaactataccccaaacttgacagagatggatgtggaagcaattattgaggaagccttt
aaagtctggagtaaagtgtcacccttgaccttcaacaggaccttggacgaagaagcagac
atccagatttcttttgcccaaagagatcatggggacaattccccatttgatggacccgat
ggaattcttgctcatgcctttcagccaggccctggtattggaggagatgttcattttgat
gcagaagaaacatggaccaaaacctctgaaaattacaacttgtttcctgttgctgcccat
gaattcggccattccttggggctggctcactcctctgatcctggggccttgatgtatccc
aattatgctttcattgaccccagcagctactcactgcatcaagatgacatcaatggcatt
caggccatctacggaccctcaagcaaccctgtgcaacctactggaccaaccacccccacc
gcctgcgaccccagactgacgtttgatgctgtcaccacactccgtggagaaatactcttc
ttcaaagacaagtacgtctggaggaagcaccctcggctacgaatggcggaattcaatttc
atttctctctactggccgtccctgccaaacggcatacatgctgcttatgaggattttgac
agggacctaattttcatattcaaaggcacccagtactgggctctgagtggctatgatact
cagcaaggttaccccaggcatatatcaagctatggcttcccgagcagtgtccaagcaatt
gacgcagctgtttcctacaggagaaaaacgtacttctttgtaaatgaccagttctggagc
tatgatgaccaaagtcaatctatggaaccaggttatccccaaagcatagcaagttttttt
ccaggaatagaaagtagagttgatgcagttttccaggagaattccttgttccttttcttc
agtggaccaagatattatgcatttgattttcatgctcgtagagttactagagtcgacaga
agcaatacgtggcttaactgttggtacagttga

DBGET integrated database retrieval system