KEGG   Bos taurus (cow): 100337128Help
Entry
100337128         CDS       T01008                                 

Gene name
UNC13C
Definition
unc-13 homolog C (C. elegans)
Orthology
K15293  
protein unc-13
Organism
bta  Bos taurus (cow)
Pathway
Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:bta00001]
 Organismal Systems
  Nervous system
   04721 Synaptic vesicle cycle
    100337128 (UNC13C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
10
AA seq 2216 aa AA seqDB search
MVANVFKSLILPYIHKLCKGMFTKKLGNTTKKKENRQPKKDQDLPVAGQTKTPKFSNTLK
STVKKLAKCSSTRNLSTKEEEANKEFSLSPTFSYRVAIANGLQKKIHVANGDHEELLQEL
SSIESSYSESLSELRSSTENQAQSALMMPVRRNRKSSSSLAPSEGSSDGERTLQSLKLGA
LRKLRKWKKSQECVSSDSELSTMKKTWGIRSKSLDRTARNPKTNALEPGFSSSVCISQTQ
DVMEMIFKELQGISQIETELSELRGHVNALKHSIDEISSSVEVVQNEIEQLRTGFVQSRR
ETRDIHDYIKHLGHVGSKASLRFLNVPEERFEYIESVVYQVLIDKMGFSDAPNAIKIEFA
QRIGHQRDCPNAKPRPILVYFETPQQRDLVLKKSYKLKGTGIGISTDILTHDIKERKERG
IPSSQTYESMDIKLSTPEPRLKNSWHSPDDSDGELASDLNRNSYAVLSKSEFPTKGSASK
SSSKSHNARAKNKTASSSKIANKSEYDKLSSHLPESDNLAKQTTTRYADVTPLWHSQSDF
FTAKLSRSESDFSKLCQSYSEDFSENQFFTRTNGSSLLSSSDRELWQRKQEGTPTMYDNP
QDQGLNGAPLGVQGQSEIEYTETVDSGVSNGMVCASGDQSHYSDSQLSLHEDLSPWKEWN
QEEKGADLGLDSSTQEAFDYDTNSLSDQPLDVYHKDLEDLGKGHSDLQDDSESYDLTQDD
NSSPCPGLDNEPQGQWVGQYNSYQEPNSNELYQNQNQLSMMYRSQSELQSDDSEDAPPKS
WHSRLSIDLSDKAFSFPKFGSTLQRAKSALEVVWNKSTQSLSGYEDSGSSLMGRFRTLSQ
STANESSTTLDSDVYTEPYYYKAEDEEDYSEPVADNETDYVEVMEQVLAKLENRTSVTET
DEQMPEYDHPSYETPYETPQDEGYDGQADDVVSEGGLEPLNEAPAEMEMKEDENQNIPEQ
LVEVTKPKRIRPSFKEAALKAYKKQMAELEEKILAGDSSSVDEKARIVSGNDLDASKFSA
LQAFGGAGRGLYGIDSMPDLRKKKTLPIVRDVAMTLAARKSGLSLAMVIRTSLNNEELKI
HVFKKTLQALIYPMSSTTPHNFEVWTATTPTYCYECEGLLWGIARQGMKCSECGVKCHEK
CQDLLNADCLQRAAEKSSKHGAEDKTQTIITAMKERMKIRETNRPEVFEVIQEMFQISKE
DFVQYTKAAKQSVLDGTSKWSAKITITVVSAQGLQAKDKTGSSDPYVTVQVGKNKRRTKT
IFGNLNPVWDEKFYFECHNSTDRIKVRVWDEDDDIKSRVKQHFKKESDDFLGQTIVEVRT
LSGEMDVWYNLEKRTDKSAVSGAIRLKINVEIKGEEKVAPYHIQYTCLHENLFHYLTEVK
ANGGVKIPEVKGDEAWKVFFDDASQEIVDEFAMRYGIESIYQAMTHFSCLSSKYMCPGVP
AVMSTLLANINAFYAHTTISTNVQVSASDRFAATNFGREKFIKLLDQLHNSLRIDLSKYR
EHFPASNAERLQDLKSTVDLLTSITFFRMKVLELQSPPKASMVVKDCVRACLDSTYKYIF
DNCHELYSQLIDPSKKQDIPREDQGPTTKNLDFWPQLITLMVTIIDEDKTAYTPVLNQFP
QELNMGKISAEIMWTLFAQDMKYALEEHEKQRLCKSTDYMNLHFKVKWFYNEYVRELPAF
KDAVPEYSLWFEPFVMQWLDENEDVSMEFLHGALGRDKKDGFQQTSDHALFSCSVVDVFA
QLNQSFEIIKKLECPNPEALSHLMRRFAKTINKVLLQYAAIVSSDFSSYCDKENVPCILM
NNIQQLRVQLEKVFESMGGKELDPEASTVLKELQVKLSGVLDELSVTYGESFQLIIEGCI
KQMSFELNQMRANGNTTSNKNSAAMDAEIVLRPLMDFLDKTLSLSAKICERTVLKRVLKE
LWKLVLNKIEKQIVLPPLTDQTGPQMIFIAAKDLGQLSKLKEHMIREDAKGLTARQCGIM
EVVLATIKQYFHAGGNGLKKNFLEKSPDLQSLRYALSLYTQTTDALIKKFIDTQTSQSRP
SKDSVGQISVHVDITATPGTGEHKVTVKVIAINDLNWQTTAMFRPFVEVCMLGPNLGDKK
RKQGTKTKSNTWSPKYNETFQFTLSKENRPGAYELHLSVKDYCFAREDRIIGMTVIQLQN
IAEKGSYGAWYPLLKNVSMDETGLTILRILSQRTSDDVAKEFVRLKSETRSAEENA
NT seq 6651 nt NT seq  +upstreamnt  +downstreamnt
atggtggctaatgttttcaagagcctgattttaccttacatccataagctttgcaaagga
atgtttacaaagaaattgggaaatacaaccaaaaaaaaagagaatcgtcagccaaaaaaa
gatcaagaccttcctgttgctggccagaccaaaacccccaaattttctaacaccttgaaa
agcacagtaaagaagcttgcaaagtgttcatccactcgcaacttatccaccaaagaagag
gaggctaacaaagaattttctctctcccccacattcagttaccgagtagctattgccaat
ggcctccagaagaagattcatgtagccaacggtgatcatgaggagctccttcaggagtta
tcttccattgagagctcctactcagaatcactcagtgaactaaggagcagtacagaaaac
caggcacagtcagcactcatgatgcccgttagacgcaacaggaagagctccagcagcctg
gcgccctcagaggggagttccgacggggaacgcactctgcagagcttaaagctaggagct
ttacgcaaactgaggaaatggaaaaagagtcaagagtgtgtctcctcggattcagagttg
agcacaatgaagaaaacctggggaatcagaagcaaatctttggaccgaactgcccgaaac
ccaaagaccaacgccctggagcctggattcagttcctctgtctgcattagccaaacgcag
gatgtcatggaaatgatctttaaggaacttcagggaataagtcagatagaaacagaactt
tctgaactccgagggcatgtcaatgctctcaagcattccattgatgagatctccagcagc
gtggaggttgtgcaaaacgaaattgagcagctgcggacagggtttgtccagtctcggagg
gaaactagagacatccatgattatattaaacacttaggtcatgtgggaagcaaagcaagc
ctgagatttttaaatgtgcccgaagaaagatttgaatatattgaaagtgtggtgtaccaa
gttctaatagataaaatgggtttttccgatgcaccaaatgctattaaaattgaatttgct
cagaggataggacaccaaagggattgcccgaatgcaaagcctcgacccatccttgtgtac
tttgaaacccctcagcaaagggatttagtcttaaaaaaatcctataaactcaaaggaaca
ggcatcggaatctcaacagatattcttactcatgacatcaaagaaagaaaagaaagaggg
ataccatcctcccagacatatgaaagcatggacataaagctatctactccagagcccaga
cttaagaacagttggcactctcctgatgacagtgatggagagctggcatctgatctcaat
agaaacagttatgctgtactttccaagtcagagtttccaacaaaaggaagtgcttccaag
tcaagttcaaaatcacacaatgctagagccaagaataaaactgctagtagcagcaaaatt
gcaaataaatcagaatatgataaactttcttcacatttgccagaatcggataacttggcc
aaacaaaccacaacccgttatgcagatgtgacacctctctggcactcacagagtgatttt
ttcactgctaaacttagccgttctgaatctgatttttccaaattgtgtcaatcttattca
gaggatttttcagaaaatcagtttttcactagaactaatggaagttccctcctgtcttct
tcagaccgggaactttggcagaggaaacaggagggcacccctaccatgtatgacaaccct
caggatcagggtttgaatggggctcctctgggtgtccaagggcagagtgaaattgaatac
acagaaaccgtggacagtggagtgagtaatggcatggtgtgtgcttctggagaccagagc
cactacagtgattctcagctctctttacatgaagatctttctccatggaaagaatggaat
caagaagagaaaggagccgatttaggtttggattcatctacccaggaagcttttgactat
gacacaaacagtctatctgatcaaccacttgatgtttaccataaagacctagaagacttg
ggaaagggccacagtgaccttcaggatgactctgagagttatgatttaacccaagatgac
aactcatctccatgccctgggctggataatgaaccacaaggacagtgggttggccagtat
aattcttatcaggaacctaattctaatgagctgtaccaaaaccaaaaccagttgtccatg
atgtatcgaagtcaaagtgaattgcaaagtgatgattcagaggatgccccacccaaatct
tggcatagtcgattaagcattgacctttccgataaggctttcagcttcccaaaatttgga
tctacactacagagagctaagtcagccttggaagtggtatggaacaaaagcacacagagt
ctcagtgggtatgaggacagcggctcttccttaatggggagatttcggacattatcccaa
tcaactgcaaatgaatcgagtacaacccttgactctgatgtctacacagaaccttattat
tacaaagcagaggatgaagaggactatagtgaaccagtggctgataatgaaacagattat
gttgaagtaatggaacaagtccttgctaagctagaaaacaggactagtgttactgaaaca
gatgaacaaatgccggagtatgatcacccttcatatgaaaccccttatgaaaccccacaa
gatgagggttatgatgggcaggcagatgatgtggttagtgaagggggattggaaccctta
aatgaagcaccggctgaaatggaaatgaaagaagacgaaaaccaaaacatccctgaacaa
ctagtggaagtcacaaagccaaagaggattcgtccctctttcaaagaagcagctttgaaa
gcctataagaagcaaatggcagaactggaagagaagatcctggctggagatagcagttct
gtggatgaaaaggctcggatagtaagtggcaatgatttggatgcttccaaattctctgca
ctacaggcgtttggtggagctggtcggggactttatggtattgacagtatgccggatctc
cgcaaaaagaaaactctgcctattgtacgagatgtggccatgaccctggctgcccggaag
tctggactctccctggctatggtgattaggacatctttaaacaatgaggaattgaaaata
catgtcttcaagaagacgctacaggcactgatctaccccatgtcctccaccaccccacac
aactttgaggtctggacggctacaacacccacctactgttacgagtgtgaagggctccta
tggggcattgcccggcaaggcatgaagtgttcggagtgtggagtgaagtgccacgaaaag
tgtcaggacctcctgaatgccgactgtttgcagagagcagcagaaaagagttctaagcat
ggtgcagaagataagactcaaaccattattacagccatgaaagaaagaatgaagatcagg
gagacaaacaggccagaggtgtttgaagtaattcaggaaatgtttcagatttctaaagaa
gattttgtgcagtacacaaaggcagccaaacagagtgtactggatgggacatctaagtgg
tcagcaaaaataaccattacagtggtttctgcacaaggcttgcaggcaaaagacaaaaca
gggtctagtgacccgtatgttacagttcaggtcggaaagaacaaaagaaggactaaaacc
atttttggaaacttgaatccagtatgggatgaaaagttttattttgagtgccataactcc
acagatcgaatcaaagtcagagtgtgggatgaagatgatgacatcaaatccagagtgaag
caacatttcaaaaaggagtcagatgattttctgggacaaacaattgtagaagtgaggacc
ctgagtggagaaatggatgtctggtacaatttagagaaacggacagataaatcagctgtg
tctggggccattcgactgaaaattaatgtggaaataaaaggagaggagaaagttgctcca
tatcatatacaatatacatgtctacatgagaatttgttccattacttgactgaagtgaaa
gctaatggtggagtgaaaatcccagaggtcaaaggggatgaagcctggaaagttttcttt
gatgacgcctctcaagaaatagtcgatgaatttgccatgcgttatgggattgaatccatt
tatcaagctatgacgcatttttcctgtctgtcttctaaatacatgtgccccggtgtccct
gctgtaatgagcaccttgctggcgaatatcaacgctttctatgctcatacaaccatttca
acaaatgtgcaagtttccgcctcagatcgatttgctgctaccaacttcggaagggaaaaa
ttcataaaactactggaccagttgcataactctttaagaattgacctgtcaaagtatagg
gaacactttcctgccagcaatgctgaaagattgcaagacctgaaatcaactgttgacctg
ctaacaagtatcaccttttttaggatgaaggttctggagctgcaaagcccccctaaggcc
agcatggtggtgaaggactgcgtcagggcttgcctggattctacgtacaaatatattttt
gacaactgccatgaactctattcccagctaatagacccgagtaagaaacaggacattcct
cgggaagatcagggaccaaccaccaagaatttggatttttggccccagcttattacactg
atggtcactattattgatgaggataaaactgcctacactcctgtcctgaatcagtttcct
caagagctgaacatgggaaaaataagtgctgaaattatgtggaccctttttgctcaggat
atgaaatatgcactagaagaacatgaaaagcagaggttatgcaagagcactgattatatg
aatttgcatttcaaagtgaaatggttttataatgaatatgtgcgggaacttcctgccttc
aaggatgccgttcctgaatactccttgtggtttgaaccttttgtcatgcagtggctagat
gaaaatgaagatgtgtcaatggagttcctacatggagccctgggaagagacaaaaaagat
ggattccaacagacatctgatcatgcgctcttctcttgctccgtggttgatgtctttgct
cagcttaatcagagctttgagattattaagaaactggaatgccccaatcctgaagcatta
tcacacttaatgagaagatttgcaaagaccatcaataaagtactacttcagtatgctgca
attgtatcaagtgatttcagttcatactgtgataaggaaaatgtgccctgtatattgatg
aacaacattcaacaattgcgggttcagctggaaaaagtgtttgaatccatgggaggaaaa
gagttagaccctgaagctagtactgttctaaaagaacttcaggttaaactcagtggggtt
ctggatgagctcagtgtcacttatggtgaaagtttccagcttatcattgaagggtgcata
aaacaaatgagtttcgaactaaatcaaatgagagcaaatggaaatactacatctaataag
aacagtgcagcaatggatgcagagattgtattaagacctctcatggacttcttggacaaa
acattaagtctctcagcaaagatctgtgagagaacagtcctgaagcgagtattgaaagaa
ttgtggaagctagttcttaacaaaatagaaaaacaaattgttctccctcctctgacagat
caaacaggaccccagatgattttcattgcagctaaagatctgggacaactctccaaactg
aaggagcacatgattcgagaggatgccaagggtctgacagcaagacagtgtggtataatg
gaggtggtcctggctaccatcaagcaatactttcatgcaggaggaaatggcctgaaaaag
aatttcttggagaaaagcccagatcttcagtctctgagatatgctctcagtctttatacc
caaacgactgatgccttgataaagaaattcatagacacccaaacctcacagagtcgcccc
tccaaagattcagtgggtcagatatctgttcatgtggacatcaccgccactccaggaacc
ggagagcataaagtcactgtaaaagtgattgctattaatgacttaaactggcagaccacg
gccatgttccgcccctttgtggaagtctgtatgctgggacccaaccttggagacaagaag
agaaaacaaggcacaaaaacaaaaagcaacacatggtcaccaaagtataatgaaacattt
cagttcactctgagtaaagaaaaccgcccaggggcctatgaactccacctttcggttaaa
gattactgctttgccagagaagatcgaattatcggaatgacagtaattcagctccagaat
atagccgaaaaggggagctacggggcatggtatccccttttgaaaaatgtctctatggat
gaaaccggtctgactatccttagaatcctctctcagaggaccagtgacgatgtggctaaa
gaatttgtaagacttaaatctgaaacaagatctgctgaagagaatgcttga

DBGET integrated database retrieval system