KEGG   Bos taurus (cow): 100847677Help
Entry
100847677         CDS       T01008                                 

Definition
cytochrome P450 4X1-like
Orthology
K07428  
cytochrome P450, family 4, subfamily X [EC:1.14.14.1]
Organism
bta  Bos taurus (cow)
Pathway
Serotonergic synapse
Class
Organismal Systems; Nervous system; Serotonergic synapse [PATH:bta04726]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 515 aa AA seqDB search
MESSWMESSWMESSWLETHWARPFYLTLVFCLALGLLQAIKLYLQRQRLLRDLRLFPSPP
THWLYGHSKLFKDGKMEILEKIVEKYPCAFPRWIGPFQAFLYIYDPDYAKTFLSRTDPKS
NFLYKFMTASVGKGLVNLSGPKWSQHRRLLTPGFHFNTLKSFVEVMAQSVNIMLNKWEKI
CGSQNTLLDIYEHINLMTLDVLMKCIFSWETNCQTDSSHDNYVKATSEGSNILMQRLFNY
FYHYDLIFKLSPLGHRLREVNKILHHHTDKIVKNRRNSLKDENKQTNTQKRKYRDFLDIV
LSAQAENDSFTDADLWSEVNTFMVAGHDSVSAGISWLLYHLALYPEHQEKCREEIRAILG
DGSSITWDQLSEMSYTTMCIKESLRLAPPAVSISRQLSKPITFPDGRSLPAGMTVVLSIW
GLHHNPAVWENPEVFDPLRFSQECNKRHSHAYLPFSSGPRNCIGQNFAIAEIKVIVALIL
LRFQMRVEPTKPVVFVPYIFIKPKKGIYLHLKKLP
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggagtcctcctggatggagtcctcctggatggagtcctcctggcttgagacgcactgg
gcaaggcccttttacctgacgttggtgttctgcttggccctagggctgctgcaggccatc
aagctctacctgcagaggcagaggctgctccgagacctgcgcctcttcccctcgcccccc
actcactggctctacgggcatagcaagttatttaaagatggtaaaatggagatccttgag
aagattgtagaaaaatacccttgtgcctttcctcgctggattgggccctttcaggcattt
ttatatatctatgatccagactatgcaaagacatttctgagcagaacagatcccaagtcc
aacttcctgtataagttcatgactgcaagcgttggaaaaggactagtgaatttgagtgga
cccaaatggtctcagcaccgtcgtctactaactcctggattccattttaataccttgaaa
tcgtttgtcgaggtgatggctcaatctgtgaacatcatgctgaataagtgggagaagatt
tgtggctctcagaatacacttctggatatctatgagcacatcaacttgatgaccctggac
gtactcatgaaatgtattttcagctgggaaaccaactgccaaacagacagctcccatgat
aattatgtaaaagcaacaagtgaaggcagcaatatccttatgcaacgcctgttcaattac
ttttatcactatgacctaattttcaaattaagtcctctgggccaccgcctgcgggaggta
aacaagatattgcatcatcatacagacaagatagtcaagaatagaaggaattccctcaag
gatgagaataagcagactaacactcagaagaggaaataccgggacttcctggatattgtc
ctttctgctcaggctgaaaatgatagcttcacagatgcagacctgtggtccgaggtgaac
acattcatggtggcagggcatgactctgtatcagcaggcatttcctggctcctctaccac
ctagctctgtaccctgagcatcaggagaaatgccgggaggagatcagagccatcctgggg
gatgggtcttccattacctgggaccaactgagcgagatgtcatacaccacaatgtgcatt
aaggagtcactccgcttggcacctccagccgtgtccatttccagacaactcagcaagccc
attacctttccagatggacggtctttgcctgcaggaatgactgtggttctcagtatctgg
ggtctccaccacaaccccgccgtctgggaaaacccagaggtctttgaccccttgaggttc
tcccaggaatgtaataaaagacactcccatgcttacttaccattctcatctggaccaagg
aactgcatcgggcagaattttgccatagctgagataaaggtgattgttgccttgattctg
ctccgcttccagatgagagtagagcccaccaagcctgttgtcttcgtgccctacattttc
atcaaacccaagaaggggatctacttgcacctgaagaaactcccctaa

DBGET integrated database retrieval system