KEGG   Bos taurus (cow): 100847677Help
Entry
100847677         CDS       T01008                                 

Definition
cytochrome P450 4X1-like
Orthology
K07428  
cytochrome P450, family 4, subfamily X [EC:1.14.14.1]
Organism
bta  Bos taurus (cow)
Pathway
Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:bta00001]
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    100847677
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100847677
Cytochrome P450 [BR:bta00199]
 Cytochrome P450, animal type
  CYP4 family
   100847677
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 515 aa AA seqDB search
MESSWMESSWMESSWLETHWARPFYLTLVFCLALGLLQAIKLYLQRQRLLRDLRLFPSPP
THWLYGHSKLFKDGKMEILEKIVEKYPCAFPRWIGPFQAFLYIYDPDYAKTFLSRTDPKS
NFLYKFMTASVGKGLVNLSGPKWSQHRRLLTPGFHFNTLKSFVEVMAQSVNIMLNKWEKI
CGSQNTLLDIYEHINLMTLDVLMKCIFSWETNCQTDSSHDNYVKATSEGSNILMQRLFNY
FYHYDLIFKLSPLGHRLREVNKILHHHTDKIVKNRRNSLKDENKQTNTQKRKYRDFLDIV
LSAQAENDSFTDADLWSEVNTFMVAGHDSVSAGISWLLYHLALYPEHQEKCREEIRAILG
DGSSITWDQLSEMSYTTMCIKESLRLAPPAVSISRQLSKPITFPDGRSLPAGMTVVLSIW
GLHHNPAVWENPEVFDPLRFSQECNKRHSHAYLPFSSGPRNCIGQNFAIAEIKVIVALIL
LRFQMRVEPTKPVVFVPYIFIKPKKGIYLHLKKLP
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggagtcctcctggatggagtcctcctggatggagtcctcctggcttgagacgcactgg
gcaaggcccttttacctgacgttggtgttctgcttggccctagggctgctgcaggccatc
aagctctacctgcagaggcagaggctgctccgagacctgcgcctcttcccctcgcccccc
actcactggctctacgggcatagcaagttatttaaagatggtaaaatggagatccttgag
aagattgtagaaaaatacccttgtgcctttcctcgctggattgggccctttcaggcattt
ttatatatctatgatccagactatgcaaagacatttctgagcagaacagatcccaagtcc
aacttcctgtataagttcatgactgcaagcgttggaaaaggactagtgaatttgagtgga
cccaaatggtctcagcaccgtcgtctactaactcctggattccattttaataccttgaaa
tcgtttgtcgaggtgatggctcaatctgtgaacatcatgctgaataagtgggagaagatt
tgtggctctcagaatacacttctggatatctatgagcacatcaacttgatgaccctggac
gtactcatgaaatgtattttcagctgggaaaccaactgccaaacagacagctcccatgat
aattatgtaaaagcaacaagtgaaggcagcaatatccttatgcaacgcctgttcaattac
ttttatcactatgacctaattttcaaattaagtcctctgggccaccgcctgcgggaggta
aacaagatattgcatcatcatacagacaagatagtcaagaatagaaggaattccctcaag
gatgagaataagcagactaacactcagaagaggaaataccgggacttcctggatattgtc
ctttctgctcaggctgaaaatgatagcttcacagatgcagacctgtggtccgaggtgaac
acattcatggtggcagggcatgactctgtatcagcaggcatttcctggctcctctaccac
ctagctctgtaccctgagcatcaggagaaatgccgggaggagatcagagccatcctgggg
gatgggtcttccattacctgggaccaactgagcgagatgtcatacaccacaatgtgcatt
aaggagtcactccgcttggcacctccagccgtgtccatttccagacaactcagcaagccc
attacctttccagatggacggtctttgcctgcaggaatgactgtggttctcagtatctgg
ggtctccaccacaaccccgccgtctgggaaaacccagaggtctttgaccccttgaggttc
tcccaggaatgtaataaaagacactcccatgcttacttaccattctcatctggaccaagg
aactgcatcgggcagaattttgccatagctgagataaaggtgattgttgccttgattctg
ctccgcttccagatgagagtagagcccaccaagcctgttgtcttcgtgccctacattttc
atcaaacccaagaaggggatctacttgcacctgaagaaactcccctaa

DBGET integrated database retrieval system