KEGG   Bos taurus (cow): 100847700Help
Entry
100847700         CDS       T01008                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
bta  Bos taurus (cow)
Pathway
bta01524  Platinum drug resistance
bta04115  p53 signaling pathway
bta04210  Apoptosis
bta04215  Apoptosis - multiple species
bta04932  Non-alcoholic fatty liver disease (NAFLD)
bta05010  Alzheimer's disease
bta05012  Parkinson's disease
bta05014  Amyotrophic lateral sclerosis (ALS)
bta05016  Huntington's disease
bta05134  Legionellosis
bta05145  Toxoplasmosis
bta05152  Tuberculosis
bta05161  Hepatitis B
bta05164  Influenza A
bta05167  Kaposi's sarcoma-associated herpesvirus infection
bta05168  Herpes simplex infection
bta05200  Pathways in cancer
bta05210  Colorectal cancer
bta05222  Small cell lung cancer
bta05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:bta00001]
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    100847700
   04215 Apoptosis - multiple species
    100847700
   04115 p53 signaling pathway
    100847700
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100847700
   05210 Colorectal cancer
    100847700
   05222 Small cell lung cancer
    100847700
  Neurodegenerative diseases
   05010 Alzheimer's disease
    100847700
   05012 Parkinson's disease
    100847700
   05014 Amyotrophic lateral sclerosis (ALS)
    100847700
   05016 Huntington's disease
    100847700
  Cardiovascular diseases
   05416 Viral myocarditis
    100847700
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100847700
  Infectious diseases
   05134 Legionellosis
    100847700
   05152 Tuberculosis
    100847700
   05164 Influenza A
    100847700
   05161 Hepatitis B
    100847700
   05168 Herpes simplex infection
    100847700
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100847700
   05145 Toxoplasmosis
    100847700
  Drug resistance
   01524 Platinum drug resistance
    100847700
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-GeneID: 100847700
NCBI-ProteinID: XP_005194076
Ensembl: ENSBTAG00000023823
UniProt: P62894
Structure
PDB: 

Jmol
Position
11
AA seq 105 aa AA seqDB search
MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITW
GEETLMEYLENPKKYIPGTKMIFAGIKKKGEREDLIAYLKKATNE
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatgttgagaagggcaagaagatttttgttcagaagtgtgcccagtgccatact
gtggaaaagggaggcaagcacaagactgggccaaacctccatggtctgtttggacgaaag
acaggtcaggctcctggattctcttacacagatgccaataagaacaaaggtatcacctgg
ggagaggagacgctgatggagtacttggagaatcccaagaagtacatccctggaacaaag
atgatctttgctggcattaagaagaagggagagagggaagacttgatagcttatctcaaa
aaagctaccaatgagtaa

DBGET integrated database retrieval system