KEGG   Bos taurus (cow): 100848132Help
Entry
100848132         CDS       T01008                                 

Definition
(RefSeq) chymotrypsinogen A
  KO
K01310  
chymotrypsin [EC:3.4.21.1]
Organism
bta  Bos taurus (cow)
Brite
Enzymes [BR:bta01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.1  chymotrypsin
     100848132
Peptidases [BR:bta01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100848132
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
18
AA seq 263 aa AA seqDB search
MNFLWLLSYCALLGTAFGCGVPAIQPVLSGLSRIVNGEEAVPGSWPWQVSLQDKTGFHFC
GGSLINENWVVTAAHCGVTTSDVVVAGEFDQGSSSEKIQKLKIAKVFKNSKYNSLTINND
ITLLKLSTAASFSQTVSAVCLPSASDDFAAGTTCVTTGWGLTRYTNANTPDRLQQASLPL
LSNTNCKKYWGTKIKDAMICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCST
STPGVYARVTALVNWVQQTLAAN
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcctctggcttctctcctactgcgccctcctgggcacagcctttggctgcggg
gtccccgccatccaacctgtgctaagcggcctctccaggattgtcaacggggaagaagct
gtccccggctcctggccctggcaggtgtccctgcaggacaagaccggcttccacttctgc
gggggctccctcatcaacgagaactgggtggtcaccgccgcccactgcggtgtcacaacc
tctgatgtggtagtggctggggagtttgaccaaggctcaagctctgagaagatccagaag
ctgaagatcgccaaggttttcaagaactccaagtacaactcgttaaccatcaacaatgac
atcaccctgctgaagctgtccacggctgcaagcttctcccagactgtgtctgctgtgtgc
ctgcccagcgccagcgacgacttcgctgccgggacgacgtgcgtcaccacaggctggggc
ctgacccgatacaccaatgccaacacccctgaccggctgcagcaggcgtccctgcccctc
ctgtccaacaccaactgcaagaaatactggggcactaagatcaaagatgccatgatctgt
gcgggcgccagcggtgtctcctcttgcatgggcgactctggcggccccctggtctgcaag
aagaatggagcctggaccctggtgggcatcgtgtcctggggcagcagcacgtgctccacg
tccacccctggcgtgtacgcccgcgtcactgctctcgtcaactgggtgcagcagaccctg
gccgccaactga

DBGET integrated database retrieval system