KEGG   Bos taurus (cow): 100848132Help
Entry
100848132         CDS       T01008                                 

Definition
chymotrypsinogen A-like
Orthology
K01310  
chymotrypsin [EC:3.4.21.1]
Organism
bta  Bos taurus (cow)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Structure
PDB: 

Jmol
Position
18
AA seq 300 aa AA seqDB search
MPRKGIITSRSSDNSLVHRDIIGSPAAGTPHLSEGSTMNFLWLLSYCALLGTAFGCGVPA
IQPVLSGLSRIVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGVTTSDV
VVAGEFDQGSSSEKIQKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTVSAVCLPS
ASDDFAAGTTCVTTGWGLTRYTNANTPDRLQQASLPLLSNTNCKKYWGTKIKDAMICAGA
SGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNWVQQTLAAN
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgcccaggaaagggattatcacatcaaggtcttcagataacagcctggtgcacagggat
ataatagggagccctgcagcaggcaccccacacctctctgaaggcagcaccatgaacttc
ctctggcttctctcctactgcgccctcctgggcacagcctttggctgcggggtccccgcc
atccaacctgtgctaagcggcctctccaggattgtcaacggggaagaagctgtccccggc
tcctggccctggcaggtgtccctgcaggacaagaccggcttccacttctgcgggggctcc
ctcatcaacgagaactgggtggtcaccgccgcccactgcggtgtcacaacctctgatgtg
gtagtggctggggagtttgaccaaggctcaagctctgagaagatccagaagctgaagatc
gccaaggttttcaagaactccaagtacaactcgttaaccatcaacaatgacatcaccctg
ctgaagctgtccacggctgcaagcttctcccagactgtgtctgctgtgtgcctgcccagc
gccagcgacgacttcgctgccgggacgacgtgcgtcaccacaggctggggcctgacccga
tacaccaatgccaacacccctgaccggctgcagcaggcgtccctgcccctcctgtccaac
accaactgcaagaaatactggggcactaagatcaaagatgccatgatctgtgcgggcgcc
agcggtgtctcctcttgcatgggcgactctggcggccccctggtctgcaagaagaatgga
gcctggaccctggtgggcatcgtgtcctggggcagcagcacgtgctccacgtccacccct
ggcgtgtacgcccgcgtcactgctctcgtcaactgggtgcagcagaccctggccgccaac
tga

DBGET integrated database retrieval system