KEGG   Bos taurus (cow): 100848343Help
Entry
100848343         CDS       T01008                                 

Gene name
ASPDH
Definition
(RefSeq) aspartate dehydrogenase domain containing
Organism
bta  Bos taurus (cow)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
18
AA seq 370 aa AA seqDB search
MEGGGVARTTQGPRTPNHLAHCPQDPPSAPTQHPLTPTFGPPQGRRKVRERTEGQSPKIS
RCPNLLCVVRGAAGSRIQTQTTEFKGMALDRVPRKVGIVGYGRLGQSLVSHLLTQGPELG
LELVFVWNRDPGRMAGSIPPSLQLQNLAALGERHPDLVVEVAHPKIIQESGAEILRYANL
LVGSPSALADQATERQLLEASHRWGHAVFVARGALWGAEDITRLDEAGGLQSLRVTMATH
PDGFRLEGPLATMRSTGPRAVLYEGPVRGLCPHAPRNSNTMAAAALAAPSLGFDRVIGVL
VADFSLKNMHVVDVELSGPPGPTGQSFAVHTHRENPAEPGAVTGSATVTTFWRSLVGCCQ
LPSKPGIHLC
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggagggggggggggtggcacgcacaacgcagggtcctagaaccccaaaccatcttgcc
cactgtccccaggatcctccttctgcccccacgcagcaccccctcacccccacctttggg
ccaccgcagggaaggaggaaggttcgggagaggaccgagggtcagagtccaaagatcagc
cgctgcccaaacctcttgtgtgtggtgagaggggcagcaggcagcagaattcagacgcag
accactgaattcaagggcatggccctcgacagagtcccgaggaaggtggggatagtgggc
tacggccgcctcggacagtccttggtctcccacttgctgactcaggggccagaactgggc
ctagaacttgtttttgtctggaaccgtgatccaggacgaatggcggggagcataccccct
tccctccagctccagaaccttgctgctctcggggagaggcaccctgaccttgtggtggaa
gtggcccatccgaaaataatccaggaatctggggcagaaatcctgcgctatgccaatctc
ctggtggggtccccctcagccctggctgaccaggccacagagcggcagctcctggaagcc
tcacatcgctggggccacgctgtgttcgtggcccggggggctctgtggggcgcggaggac
atcaccagattggacgaagccgggggcctccagagcctccgtgtcaccatggccacacac
cctgatggcttccggctcgagggacccctggctacaatgcgcagtaccgggcctcgcgct
gtgctctatgaaggccctgttcgcgggctttgcccccacgccccccgaaactccaacacc
atggcggcggctgccctggccgcccccagcctgggcttcgaccgtgtgatcggggtgctt
gtggctgatttcagcctcaagaacatgcacgtggtggatgtggagctgagcggacccccg
ggccccacaggccaaagcttcgctgtgcacacacacagagagaaccccgcagagccaggc
gctgtcaccggctctgccaccgtcaccaccttctggcgcagcctcgtgggctgctgccag
ctcccctccaagccggggatccatctctgctga

DBGET integrated database retrieval system