KEGG   Bos taurus (cow): 100848343Help
Entry
100848343         CDS       T01008                                 

Definition
josephin-2-like
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
bta  Bos taurus (cow)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
18
AA seq 188 aa AA seqDB search
MSQAPGAQPSPPSVYHERQRLELCAVHALNNVLQQQLFSQEAADEICKRLAPDSRLNPHR
SLLGTGNYDVNVIMAALQGQGLAAVWWDRRRPLSQLALPRVLGLILNLPSPVSLGLLSLP
LRRRHWVALRQVDGVYYNLDSKLRAPEVLGDEDGVRAFLAAALAQGLCEVLLVVTKEVEE
QGSWLQAD
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaggccccaggagctcagccaagcccgccctccgtgtaccacgaacggcaacgc
ctggagctctgtgccgtgcacgccctcaacaacgtcctgcagcagcagctcttcagccag
gaggctgccgatgagatctgcaagaggttggccccagactcccggctgaacccccatcgc
agcctcctgggcaccggcaactacgacgtcaacgtgatcatggctgccctgcaggggcag
ggcctggctgccgtgtggtgggaccgaaggaggcccctgtcccagctggcgctgccccgg
gtactggggctgatcctgaacctgccgtcgcccgtctcgctggggctgctgtccctgccc
ctgcgccggcggcactgggtggccctgcgccaggtggacggcgtctactacaacctggat
tccaagctgcgggcgcccgaggtgctgggcgacgaggacggcgtcagggccttcctggcg
gccgcgctggctcaaggtttgtgcgaggtgctgctggtggtaaccaaggaggtggaggag
cagggctcctggctgcaggcagactga

DBGET integrated database retrieval system