KEGG   Bos taurus (cow): 100850794Help
Entry
100850794         CDS       T01008                                 

Definition
cytochrome c-like
Orthology
K08738  
cytochrome c
Organism
bta  Bos taurus (cow)
Pathway
Sulfur metabolism
Metabolic pathways
p53 signaling pathway
Apoptosis
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Amyotrophic lateral sclerosis (ALS)
Huntington's disease
Legionellosis
Toxoplasmosis
Tuberculosis
Hepatitis B
Influenza A
Herpes simplex infection
Pathways in cancer
Colorectal cancer
Small cell lung cancer
Viral myocarditis
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    100850794
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    100850794
   04115 p53 signaling pathway
    100850794
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100850794
   05210 Colorectal cancer
    100850794
   05222 Small cell lung cancer
    100850794
  Neurodegenerative diseases
   05010 Alzheimer's disease
    100850794
   05012 Parkinson's disease
    100850794
   05014 Amyotrophic lateral sclerosis (ALS)
    100850794
   05016 Huntington's disease
    100850794
  Cardiovascular diseases
   05416 Viral myocarditis
    100850794
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100850794
  Infectious diseases
   05134 Legionellosis
    100850794
   05152 Tuberculosis
    100850794
   05164 Influenza A
    100850794
   05161 Hepatitis B
    100850794
   05168 Herpes simplex infection
    100850794
   05145 Toxoplasmosis
    100850794
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
11
AA seq 105 aa AA seqDB search
MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITW
GEETLMEYLENPKKYIPGTKMIFAGIKKKGEREDLIAYLKKATNE
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatgttgagaagggcaagaagatttttgttcagaagtgtgcccagtgccatact
gtggaaaagggaggcaagcacaagactgggccaaacctccatggtctgtttggacgaaag
acaggtcaggctcctggattctcttacacagatgccaataagaacaaaggtatcacctgg
ggagaggagacgctgatggagtacttggagaatcccaagaagtacatccctggaacaaag
atgatctttgctggcattaagaagaagggagagagggaagacttgatagcttatctcaaa
aaagctaccaatgagtaa

DBGET integrated database retrieval system