KEGG   Bos taurus (cow): 280711Help
Entry
280711            CDS       T01008                                 

Gene name
ACR
Definition
acrosin (EC:3.4.21.10)
Orthology
K01317  
acrosin [EC:3.4.21.10]
Organism
bta  Bos taurus (cow)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
5q35
AA seq 414 aa AA seqDB search
MLPTAILLVLAVSVVTRDNTTCDGPCGTRFRQNRQGGMRIIGGQDAAHGSWPWMVSLQIF
TYHNNRRYHVCGGSLLNAHWLLTAAHCFRIKKKVTDWRLIFGAKEVEWGSNKPVKPPLQE
RYVEKIIIHEKYSASSEANDIALIKITPPVICGHFIGPGCLPQFRAGPPRVPQTCWVAGW
GFLRENARRTSPVLQEAHVDLIDLDLCNSTRWYNGHIRSTNVCAGYPEGKIDTCQGDSGG
PLMCKDSVENSYVVVGITSWGVGCARAKRPGVYTSTWSYLNWIASKIGSNTVHMIQLPTA
PPASTPAAQASPGSVQPSIRPPWFFQHVPQPPPSQQAIAVAQPSRPSSPRSSVPPAPRPP
RPPPPQPSTRPPQALSFAKRLQQLIEVLKGKTFLNEKSNYEMETTGLPGQHASS
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgctgccaactgccattctgctggtcttggcagtatctgtggtcaccagagataacacc
acgtgtgatggcccctgtgggacacggttccggcagaaccgtcaggggggcatgcggatc
atcggcgggcaagacgctgcccacgggtcctggccctggatggtcagcctccagatcttc
acataccacaacaaccggcggtaccacgtgtgtgggggctccctgctgaacgcccactgg
ctgctcactgccgctcactgcttcaggatcaaaaaaaaagtgaccgactggaggctgatc
tttggagctaaggaagttgagtgggggagcaataagccagtgaagccgcctctgcaggag
agatatgttgagaaaatcatcattcatgagaaatactcggcgagctcagaggccaacgac
attgctctcataaagatcacccctcctgttatctgtgggcacttcattggaccaggctgc
ctgcctcagtttagggcaggcccacccagagttccccagacatgctgggtggctggctgg
ggattcttacgtgagaatgcccgcaggacatcacctgtgctgcaggaggcgcatgtggac
cttatcgacctcgacttgtgtaactcgaccagatggtacaatgggcacattcgttcaacc
aatgtgtgcgcagggtaccctgaaggcaagattgacacctgccagggggacagcggcggg
cctctcatgtgcaaagacagcgtggaaaacagctatgtggtcgtgggaatcacaagctgg
ggggtaggctgtgcccgagctaagcgccccggagtctacacgtctacctggtcctatctg
aactggattgcctccaagataggctctaacacggtgcacatgattcagttgcccaccgct
ccccctgcttctactccagcagcccaagcgagccctggctccgttcagccttccattcgc
ccaccttggttcttccaacacgttcctcaaccacctccctctcagcaagctattgccgtg
gcccaaccctcacgtccctcaagcccccggtcctcagtcccacctgccccccgaccccca
cgaccacccccaccgcagccttccactaggcctccccaggcactctcctttgccaagcga
ctgcagcagctcatagaggtcttgaagggaaagacctttcttaacgagaagagcaattat
gaaatggaaaccacaggccttccaggacaacatgcctcctcctga

DBGET integrated database retrieval system