KEGG   Bos taurus (cow): 280758Help
Entry
280758            CDS       T01008                                 

Gene name
DBH
Definition
dopamine beta-hydroxylase (dopamine beta-monooxygenase) (EC:1.14.17.1)
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
bta  Bos taurus (cow)
Pathway
Tyrosine metabolism
Metabolic pathways
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:bta00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
11
AA seq 610 aa AA seqDB search
MQVPSPSVREAASMYGTAVAVFLVILVAALQGSAPAESPFPFHIPLDPEGTLELSWNISY
AQETIYFQLLVRELKAGVLFGMSDRGELENADLVVLWTDRDGAYFGDAWSDQKGQVHLDS
QQDYQLLRAQRTPEGLYLLFKRPFGTCDPNDYLIEDGTVHLVYGFLEEPLRSLESINTSG
LHTGLQRVQLLKPSIPKPALPADTCTMEIRAPDVLIPGQQTTYWCYVTELPDGFPRHHIV
MYEPIVTEGNEALVHHMEVFQCAAEFRDHPHFSGPCDSKMKPQRLNFCRHVLAAWALGAK
AFYYPEEAGLAFGGPGSSRFLRLEVHYHNPLVITGRRDSSGIRLYYTAALRRFDAGIMEL
GLAYTPVMAIPPQETAFVLTGYCTDKCTQLALPASGIHIFASQLHTHLTGRKVVTVLARD
GRETEIVNRDNHYSPHFQEIRMLKKVVSVQPGDVLITSCTYNTEDRRLATVGGFGILEEM
CVNYVHYYPQTQLELCKSAVDPGFLHKYFRLVNRFNSEEVCTCPQASVPEQFASVPWNSF
NREVLKALYGFAPISMHCNRSSAVRFQGEWNRQPLPEIVSRLEEPTPQCPASQAQSPAGP
TVLNISGGKG
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtccccagccccagcgtgcgcgaggcggcctccatgtacggcaccgcggtggcc
gtcttcctggtcatcctcgtggctgcactgcagggctcggcccccgccgagagccccttc
cccttccacatccccctggaccccgaggggaccctggagctgtcctggaacatcagctat
gcgcaggagaccatctacttccagctcctggtgcgggagctcaaggctggtgtcctgttt
gggatgtcggaccgaggggagctggagaatgctgacttggtggtgctctggactgacagg
gacggcgcctactttggggatgcctggagtgaccagaaggggcaggtccacctggactcc
cagcaggattaccagcttctgcgggcacagaggactccagaaggcctgtacctgctcttc
aagaggccttttggcacctgtgaccccaacgactacctcatcgaggacggcaccgtccac
ctggtgtatggattcctggaggagccgctccggtcgctggagtccatcaacacatccggc
ttgcacacggggctgcagagggtgcagctgctgaagcccagcatcccgaagccggccctg
cccgcggacacgtgcaccatggagatccgcgcccccgacgtcctcatccccggccagcag
accacgtactggtgctacgtgaccgagctcccggacggcttcccccggcaccacatcgtc
atgtacgagcccatcgtcaccgagggcaacgaggcgctggtgcaccacatggaggtcttt
cagtgcgccgccgagtttcgagaccatccccacttcagcgggccctgcgactccaagatg
aagccgcagcggctcaacttctgccgtcacgtgctggccgcctgggccctgggcgccaag
gccttttactacccagaggaagcaggcctggccttcggggggcccggctcctccagattt
ctccgcctggaagttcactaccacaacccactggtgataacaggccggcgcgactcctcg
ggcatccgcctgtactacacggctgcgctgcggcgcttcgacgcgggcatcatggagctg
ggcctggcgtacacgcccgtgatggccatccccccgcaggagacggccttcgtcctcacc
ggctactgcacggacaagtgcacccagctggccctgcccgcctcagggattcacatcttc
gcctctcagctccacacgcacctgaccggccggaaggtggtcacagtgctggccagggac
ggccgggagacagagatcgtgaacagggacaaccactacagcccacacttccaggagatc
cgcatgttgaagaaggtcgtgtctgtccagccgggagacgtgctcatcacctcttgcaca
tacaacacggaagacaggaggctggccaccgtggggggcttcgggatcctggaggagatg
tgcgtcaactatgtgcactactacccccagacgcagctggagctctgcaagagcgccgtg
gaccctggcttcctgcacaagtacttccgcctcgtgaacaggttcaacagcgaggaagtc
tgcacctgcccccaggcgtctgtccctgagcagtttgcctccgtgccctggaactccttc
aaccgcgaggtgctcaaggccctgtacggcttcgcacccatctccatgcactgcaacagg
tcctcggccgtccgcttccagggcgagtggaatcggcagcccctgcctgagatcgtgtcc
aggttggaagagcccacccctcagtgcccagccagccaggctcagagccccgccggcccc
accgtgctgaacatcagtgggggcaaaggctga

DBGET integrated database retrieval system