KEGG   Bos taurus (cow): 280758Help
Entry
280758            CDS       T01008                                 

Gene name
DBH
Definition
dopamine beta-hydroxylase (dopamine beta-monooxygenase) (EC:1.14.17.1)
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
bta  Bos taurus (cow)
Pathway
Tyrosine metabolism
Metabolic pathways
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    280758 (DBH)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     280758 (DBH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
11
AA seq 610 aa AA seqDB search
MQVPSPSVREAASMYGTAVAVFLVILVAALQGSAPAESPFPFHIPLDPEGTLELSWNISY
AQETIYFQLLVRELKAGVLFGMSDRGELENADLVVLWTDRDGAYFGDAWSDQKGQVHLDS
QQDYQLLRAQRTPEGLYLLFKRPFGTCDPNDYLIEDGTVHLVYGFLEEPLRSLESINTSG
LHTGLQRVQLLKPSIPKPALPADTCTMEIRAPDVLIPGQQTTYWCYVTELPDGFPRHHIV
MYEPIVTEGNEALVHHMEVFQCAAEFRDHPHFSGPCDSKMKPQRLNFCRHVLAAWALGAK
AFYYPEEAGLAFGGPGSSRFLRLEVHYHNPLVITGRRDSSGIRLYYTAALRRFDAGIMEL
GLAYTPVMAIPPQETAFVLTGYCTDKCTQLALPASGIHIFASQLHTHLTGRKVVTVLARD
GRETEIVNRDNHYSPHFQEIRMLKKVVSVQPGDVLITSCTYNTEDRRLATVGGFGILEEM
CVNYVHYYPQTQLELCKSAVDPGFLHKYFRLVNRFNSEEVCTCPQASVPEQFASVPWNSF
NREVLKALYGFAPISMHCNRSSAVRFQGEWNRQPLPEIVSRLEEPTPQCPASQAQSPAGP
TVLNISGGKG
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtccccagccccagcgtgcgcgaggcggcctccatgtacggcaccgcggtggcc
gtcttcctggtcatcctcgtggctgcactgcagggctcggcccccgccgagagccccttc
cccttccacatccccctggaccccgaggggaccctggagctgtcctggaacatcagctat
gcgcaggagaccatctacttccagctcctggtgcgggagctcaaggctggtgtcctgttt
gggatgtcggaccgaggggagctggagaatgctgacttggtggtgctctggactgacagg
gacggcgcctactttggggatgcctggagtgaccagaaggggcaggtccacctggactcc
cagcaggattaccagcttctgcgggcacagaggactccagaaggcctgtacctgctcttc
aagaggccttttggcacctgtgaccccaacgactacctcatcgaggacggcaccgtccac
ctggtgtatggattcctggaggagccgctccggtcgctggagtccatcaacacatccggc
ttgcacacggggctgcagagggtgcagctgctgaagcccagcatcccgaagccggccctg
cccgcggacacgtgcaccatggagatccgcgcccccgacgtcctcatccccggccagcag
accacgtactggtgctacgtgaccgagctcccggacggcttcccccggcaccacatcgtc
atgtacgagcccatcgtcaccgagggcaacgaggcgctggtgcaccacatggaggtcttt
cagtgcgccgccgagtttcgagaccatccccacttcagcgggccctgcgactccaagatg
aagccgcagcggctcaacttctgccgtcacgtgctggccgcctgggccctgggcgccaag
gccttttactacccagaggaagcaggcctggccttcggggggcccggctcctccagattt
ctccgcctggaagttcactaccacaacccactggtgataacaggccggcgcgactcctcg
ggcatccgcctgtactacacggctgcgctgcggcgcttcgacgcgggcatcatggagctg
ggcctggcgtacacgcccgtgatggccatccccccgcaggagacggccttcgtcctcacc
ggctactgcacggacaagtgcacccagctggccctgcccgcctcagggattcacatcttc
gcctctcagctccacacgcacctgaccggccggaaggtggtcacagtgctggccagggac
ggccgggagacagagatcgtgaacagggacaaccactacagcccacacttccaggagatc
cgcatgttgaagaaggtcgtgtctgtccagccgggagacgtgctcatcacctcttgcaca
tacaacacggaagacaggaggctggccaccgtggggggcttcgggatcctggaggagatg
tgcgtcaactatgtgcactactacccccagacgcagctggagctctgcaagagcgccgtg
gaccctggcttcctgcacaagtacttccgcctcgtgaacaggttcaacagcgaggaagtc
tgcacctgcccccaggcgtctgtccctgagcagtttgcctccgtgccctggaactccttc
aaccgcgaggtgctcaaggccctgtacggcttcgcacccatctccatgcactgcaacagg
tcctcggccgtccgcttccagggcgagtggaatcggcagcccctgcctgagatcgtgtcc
aggttggaagagcccacccctcagtgcccagccagccaggctcagagccccgccggcccc
accgtgctgaacatcagtgggggcaaaggctga

DBGET integrated database retrieval system