KEGG   Bos taurus (cow): 280849Help
Entry
280849            CDS       T01008                                 

Gene name
LYZ2
Definition
lysozyme C-2 (EC:3.2.1.17)
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
bta  Bos taurus (cow)
Pathway
Salivary secretion
Brite
KEGG Orthology (KO) [BR:bta00001]
 Organismal Systems
  Digestive system
   04970 Salivary secretion
    280849 (LYZ2)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     280849 (LYZ2)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   280849 (LYZ2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q23
AA seq 147 aa AA seqDB search
MKALVILGFLFLSVAVQGKVFERCELARTLKKLGLDGYKGVSLANWLCLTKWESSYNTKA
TNYNPSSESTDYGIFQINSKWWCNDGKTPNAVDGCHVSCSELMENDIAKAVACAKHIVSE
QGITAWVAWKSHCRDHDVSSYVEGCTL
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctctcgttattctggggtttctcttcctttctgtcgctgtccaaggcaaggtc
tttgagagatgtgagcttgccagaactctgaagaaacttggactggacggctataaggga
gtcagcctggcaaactggttgtgtttgaccaaatgggaaagcagttataacacaaaagct
acaaactacaatcctagcagtgaaagcactgattatgggatatttcagatcaacagcaaa
tggtggtgtaatgatggcaaaacccctaatgcagttgacggctgtcatgtatcctgcagc
gaattaatggaaaatgacatcgctaaagctgtagcgtgtgcaaagcatattgtcagtgag
caaggcattacagcctgggtggcatggaaaagtcattgtcgagaccatgacgtcagcagt
tacgttgagggttgcaccctgtaa

DBGET integrated database retrieval system