KEGG   Bos taurus (cow): 280924Help
Entry
280924            CDS       T01008                                 

Gene name
SCD, SCD1
Definition
stearoyl-CoA desaturase (delta-9-desaturase) (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
bta  Bos taurus (cow)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
PPAR signaling pathway
AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    280924 (SCD)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    280924 (SCD)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    280924 (SCD)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    280924 (SCD)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     280924 (SCD)
Lipid biosynthesis proteins [BR:bta01004]
 Desaturase
  First
   280924 (SCD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
26
AA seq 359 aa AA seqDB search
MPAHLLQEEISSSYTTTTTITAPPSRVLQNGGGKLEKTPLYLEEDIRPEMRDDIYDPTYQ
DKEGPKPKLEYVWRNIILMSLLHLGALYGITLIPTCKIYTYIWVLFYYLMGALGITAGAH
RLWSHRTYKARLPLRVFLIIGNTMAFQNDVFEWSRDHRAHHKFSETDADPHNSRRGFFFS
HVGWLLVRKHPAVKEKGSTLNLSDLRAEKLVMFQRRYYKPGVLLLCFILPTLVPWYLWDE
TFQNSLFFATLFRYALGLNVTWLVNSAAHMYGYRPYDKTINPRENILVSLGAAGEGFHNY
HHTFPYDYSASEYRWHINFTTFFIDCMAAIGLAYDRKKVSKAAILARIKRTGEESYKSG
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgccggcccacttgctgcaagaggagatctctagctcctacacaaccaccaccaccatc
acagcacctccttccagggtcctgcagaatggagggggcaaattggagaagactccccta
tacttggaagaagacatccgccctgaaatgagagatgacatctatgacccaacttaccag
gataaggagggcccaaagcccaagcttgagtatgtttggagaaacatcatcctcatgtct
ctgttacacttgggagccctatatgggatcacattgatccccacctgcaagatatacacc
tatatctgggtgttattctactatctgatgggtgccctgggcatcacagcaggggcccat
cgcctgtggagtcaccgaacctacaaagctcggctgcctctgcgggtcttcctgatcatt
ggcaacaccatggcgttccagaatgacgtttttgaatggtcccgagatcaccgtgcccac
cacaagttttcagaaacggatgccgacccccacaattcccgacgtggctttttcttctct
cacgtgggttggctgcttgtgcgcaaacacccagctgtcaaagaaaagggttccacgcta
aatttatccgacctaagagccgagaagctggtgatgttccagaggaggtactacaaacct
ggtgtcctgttgttgtgcttcatcctgcccacactcgtgccatggtatctgtgggatgaa
acgtttcaaaacagcctgttttttgccaccttattccgttatgcccttgggctcaacgtc
acctggctggtgaatagtgctgcccatatgtatggataccgcccttatgacaagaccatc
aacccccgagagaatattctggtttccctgggagctgcgggtgagggcttccacaactac
caccacacctttccttatgactactcagccagtgagtaccgctggcacatcaactttacc
acgttcttcattgattgcatggctgccatcggtctggcttatgaccggaagaaagtatcc
aaggctgccatcttggccaggataaaaagaactggagaggaaagctacaagagtggctga

DBGET integrated database retrieval system