KEGG   Bos taurus (cow): 280924Help
Entry
280924            CDS       T01008                                 

Gene name
SCD, SCD1
Definition
stearoyl-CoA desaturase (delta-9-desaturase) (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
bta  Bos taurus (cow)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
PPAR signaling pathway
Class
Metabolism; Overview; Fatty acid metabolism [PATH:bta01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:bta01040]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:bta03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
26
AA seq 359 aa AA seqDB search
MPAHLLQEEISSSYTTTTTITAPPSRVLQNGGGKLEKTPLYLEEDIRPEMRDDIYDPTYQ
DKEGPKPKLEYVWRNIILMSLLHLGALYGITLIPTCKIYTYIWVLFYYLMGALGITAGAH
RLWSHRTYKARLPLRVFLIIGNTMAFQNDVFEWSRDHRAHHKFSETDADPHNSRRGFFFS
HVGWLLVRKHPAVKEKGSTLNLSDLRAEKLVMFQRRYYKPGVLLLCFILPTLVPWYLWDE
TFQNSLFFATLFRYALGLNVTWLVNSAAHMYGYRPYDKTINPRENILVSLGAAGEGFHNY
HHTFPYDYSASEYRWHINFTTFFIDCMAAIGLAYDRKKVSKAAILARIKRTGEESYKSG
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgccggcccacttgctgcaagaggagatctctagctcctacacaaccaccaccaccatc
acagcacctccttccagggtcctgcagaatggagggggcaaattggagaagactccccta
tacttggaagaagacatccgccctgaaatgagagatgacatctatgacccaacttaccag
gataaggagggcccaaagcccaagcttgagtatgtttggagaaacatcatcctcatgtct
ctgttacacttgggagccctatatgggatcacattgatccccacctgcaagatatacacc
tatatctgggtgttattctactatctgatgggtgccctgggcatcacagcaggggcccat
cgcctgtggagtcaccgaacctacaaagctcggctgcctctgcgggtcttcctgatcatt
ggcaacaccatggcgttccagaatgacgtttttgaatggtcccgagatcaccgtgcccac
cacaagttttcagaaacggatgccgacccccacaattcccgacgtggctttttcttctct
cacgtgggttggctgcttgtgcgcaaacacccagctgtcaaagaaaagggttccacgcta
aatttatccgacctaagagccgagaagctggtgatgttccagaggaggtactacaaacct
ggtgtcctgttgttgtgcttcatcctgcccacactcgtgccatggtatctgtgggatgaa
acgtttcaaaacagcctgttttttgccaccttattccgttatgcccttgggctcaacgtc
acctggctggtgaatagtgctgcccatatgtatggataccgcccttatgacaagaccatc
aacccccgagagaatattctggtttccctgggagctgcgggtgagggcttccacaactac
caccacacctttccttatgactactcagccagtgagtaccgctggcacatcaactttacc
acgttcttcattgattgcatggctgccatcggtctggcttatgaccggaagaaagtatcc
aaggctgccatcttggccaggataaaaagaactggagaggaaagctacaagagtggctga

DBGET integrated database retrieval system