KEGG   Bos taurus (cow): 280930Help
Entry
280930            CDS       T01008                                 

Gene name
RNASE1, RAC1, SRN
Definition
ribonuclease, RNase A family, 1 (pancreatic) (EC:3.1.27.5)
Orthology
K01168  
pancreatic ribonuclease [EC:3.1.27.5]
Organism
bta  Bos taurus (cow)
Brite
Enzymes [BR:bta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.5  pancreatic ribonuclease
     280930 (RNASE1)
Messenger RNA biogenesis [BR:bta03019]
 Eukaryotic Type
  mRNA degradation factors
   Other degradation factors
    RNases
     280930 (RNASE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
10
AA seq 150 aa AA seqDB search
MALKSLVVLPLLVLVLLLVRVQPSLGKESAAAKFERQHMDSGNSPSSSSNYCNLMMCCRK
MTQGKCKPVNTFVHESLADVKAVCSQKKVTCKNGQTNCYQSKSTMRITDCRETGSSKYPN
CAYKTTQVEKHIIVACGGKPSVPVHFDASV
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atggctctgaagtctctagtcgtgttgccactgctggtcctggtgctgctgctggtgcgg
gtccagccttccctgggcaaggaatctgcagctgccaagttcgagcggcagcacatggac
tctggcaactcccccagcagcagctccaactactgcaacctgatgatgtgctgccggaag
atgacccaggggaaatgcaagccagtgaacacctttgtgcatgagtccctggccgatgtt
aaggccgtgtgctcccagaagaaagtcacttgcaagaatgggcagaccaactgctaccag
agcaaatccaccatgcgcatcacagactgccgcgagactggcagctccaagtaccccaac
tgcgcctacaagaccacccaggtggagaaacacatcatagtggcttgtggcggtaaaccg
tccgtgccagtccacttcgatgcttcagtgtag

DBGET integrated database retrieval system