KEGG   Bos taurus (cow): 280951Help
Entry
280951            CDS       T01008                                 

Gene name
TYR
Definition
tyrosinase (oculocutaneous albinism IA) (EC:1.14.18.1)
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
bta  Bos taurus (cow)
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Melanogenesis
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    280951 (TYR)
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    280951 (TYR)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    280951 (TYR)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     280951 (TYR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
29qter
AA seq 530 aa AA seqDB search
MLLAALYCLLWSFRTSAGHFPRACASSKSLTEKECCPPWAGDGSPCGRLSGRGSCQDVIL
STAPLGPQFPFTGVDDRESWPSIFYNRTCQCFSNFMGFNCGSCKFGFRGPRCTERRLLVR
RNIFDLSVPEKNKFLAYLTLAKHTTSPDYVIPTGTYGQMNHGTTPLFNDVSAYDLFVWMH
YYVSRDTLLGDSEVWRDIDFAHEAPGFLPWHRLFLLLWEQEIQKLTGDENFTIPYWDWRD
AENCDVCTDEYMGGRNPANPNLLSPASFFSSWQIVCSRLEEYNSRQALCNGTSEGPLLRN
PGNHDKARTPRLPSSADVEFCLSLTQYESGSMDKAANFSFRNTLEGFADPVTGIADASQS
SMHNALHIYMNGTMSQVPGSANDPIFLLHHAFVDSIFEQWLRKYHPLQDVYPEANAPIGH
NRESYMVPFIPLYRNGDFFISSKDLGYDYSYLQDSEPDIFQDYIKPYLEQAQRIWPWLIG
AAVVGSVLTAVLGGLTSLLCRRKRNQLPEEKQPLLMEKEDYHNLMYQSHL
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgctcctggctgccctgtactgcctactgtggagtttccgaacctccgctggccacttc
cctcgagcctgtgcctcctccaagagcctgacggagaaggagtgctgcccgccctgggcg
ggcgatgggagcccctgtggccggctctcaggcaggggctcctgccaggacgtcattctg
tccacggcaccactcggacctcagttccccttcacgggggtggacgaccgcgagtcttgg
ccctccatcttttataacagaacctgccagtgctttagcaacttcatgggattcaattgc
ggaagttgtaagtttggatttaggggaccccgctgcacagaaaggcgacttttggtgaga
agaaacatctttgatttgagtgtcccagagaagaacaagtttcttgcctatctcactttg
gcaaaacataccaccagcccagactacgtcatccccacgggcacctatggccaaatgaat
catggaacaacacccctgtttaatgacgtcagtgcttacgacctctttgtctggatgcat
tattatgtgtcaagggacacgctgcttggggactctgaagtctggagagacattgatttt
gctcatgaagccccaggtttcctgccttggcatagactcttcctgctgctgtgggaacag
gaaatccagaagctgaccggggatgagaacttcacgattccatactgggactggagagat
gcagaaaactgtgacgtttgcacagatgagtacatgggagggcgcaaccctgcaaaccct
aatctactcagcccagcatccttcttctcctcttggcagatcgtctgcagcagactggag
gagtacaacagtcgccaggctttatgcaacgggacgtctgagggaccattactgcgcaat
cctggaaaccacgacaaagccaggaccccgaggctcccctcctcggctgatgtggagttt
tgcctgagtttgacccagtatgaatcaggttccatggataaagctgccaatttcagcttt
agaaataccctggaaggatttgctgatccagttactgggatagcagatgcctctcaaagc
agtatgcacaatgccttgcacatctacatgaacggaacgatgtcccaggtaccaggatct
gccaatgatcccatcttccttcttcatcacgcgtttgttgacagtatttttgaacagtgg
cttcgaaagtatcatcctcttcaagatgtttatccagaagctaatgcacccattgggcac
aaccgggaatcctacatggttcctttcatccctctctacagaaacggtgacttctttatt
tcatccaaagatctaggctacgactatagctacctacaagattcagaaccggacattttt
caagattacattaagccctacttagaacaagcgcaacgaatctggccgtggctcattggg
gcagctgtggttgggtccgtccttactgctgtgctgggaggacttactagcctgttatgt
cgtcgaaagagaaaccagcttccagaagaaaagcagcccctgctcatggaaaaagaggat
taccacaatttgatgtatcagagccatttatga

DBGET integrated database retrieval system