KEGG   Bos taurus (cow): 280951Help
Entry
280951            CDS       T01008                                 

Gene name
TYR
Definition
tyrosinase (oculocutaneous albinism IA) (EC:1.14.18.1)
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
bta  Bos taurus (cow)
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Melanogenesis
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:bta00350]
Metabolism; Metabolism of cofactors and vitamins; Riboflavin metabolism [PATH:bta00740]
Organismal Systems; Endocrine system; Melanogenesis [PATH:bta04916]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
29qter
AA seq 530 aa AA seqDB search
MLLAALYCLLWSFRTSAGHFPRACASSKSLTEKECCPPWAGDGSPCGRLSGRGSCQDVIL
STAPLGPQFPFTGVDDRESWPSIFYNRTCQCFSNFMGFNCGSCKFGFRGPRCTERRLLVR
RNIFDLSVPEKNKFLAYLTLAKHTTSPDYVIPTGTYGQMNHGTTPLFNDVSAYDLFVWMH
YYVSRDTLLGDSEVWRDIDFAHEAPGFLPWHRLFLLLWEQEIQKLTGDENFTIPYWDWRD
AENCDVCTDEYMGGRNPANPNLLSPASFFSSWQIVCSRLEEYNSRQALCNGTSEGPLLRN
PGNHDKARTPRLPSSADVEFCLSLTQYESGSMDKAANFSFRNTLEGFADPVTGIADASQS
SMHNALHIYMNGTMSQVPGSANDPIFLLHHAFVDSIFEQWLRKYHPLQDVYPEANAPIGH
NRESYMVPFIPLYRNGDFFISSKDLGYDYSYLQDSEPDIFQDYIKPYLEQAQRIWPWLIG
AAVVGSVLTAVLGGLTSLLCRRKRNQLPEEKQPLLMEKEDYHNLMYQSHL
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgctcctggctgccctgtactgcctactgtggagtttccgaacctccgctggccacttc
cctcgagcctgtgcctcctccaagagcctgacggagaaggagtgctgcccgccctgggcg
ggcgatgggagcccctgtggccggctctcaggcaggggctcctgccaggacgtcattctg
tccacggcaccactcggacctcagttccccttcacgggggtggacgaccgcgagtcttgg
ccctccatcttttataacagaacctgccagtgctttagcaacttcatgggattcaattgc
ggaagttgtaagtttggatttaggggaccccgctgcacagaaaggcgacttttggtgaga
agaaacatctttgatttgagtgtcccagagaagaacaagtttcttgcctatctcactttg
gcaaaacataccaccagcccagactacgtcatccccacgggcacctatggccaaatgaat
catggaacaacacccctgtttaatgacgtcagtgcttacgacctctttgtctggatgcat
tattatgtgtcaagggacacgctgcttggggactctgaagtctggagagacattgatttt
gctcatgaagccccaggtttcctgccttggcatagactcttcctgctgctgtgggaacag
gaaatccagaagctgaccggggatgagaacttcacgattccatactgggactggagagat
gcagaaaactgtgacgtttgcacagatgagtacatgggagggcgcaaccctgcaaaccct
aatctactcagcccagcatccttcttctcctcttggcagatcgtctgcagcagactggag
gagtacaacagtcgccaggctttatgcaacgggacgtctgagggaccattactgcgcaat
cctggaaaccacgacaaagccaggaccccgaggctcccctcctcggctgatgtggagttt
tgcctgagtttgacccagtatgaatcaggttccatggataaagctgccaatttcagcttt
agaaataccctggaaggatttgctgatccagttactgggatagcagatgcctctcaaagc
agtatgcacaatgccttgcacatctacatgaacggaacgatgtcccaggtaccaggatct
gccaatgatcccatcttccttcttcatcacgcgtttgttgacagtatttttgaacagtgg
cttcgaaagtatcatcctcttcaagatgtttatccagaagctaatgcacccattgggcac
aaccgggaatcctacatggttcctttcatccctctctacagaaacggtgacttctttatt
tcatccaaagatctaggctacgactatagctacctacaagattcagaaccggacattttt
caagattacattaagccctacttagaacaagcgcaacgaatctggccgtggctcattggg
gcagctgtggttgggtccgtccttactgctgtgctgggaggacttactagcctgttatgt
cgtcgaaagagaaaccagcttccagaagaaaagcagcccctgctcatggaaaaagaggat
taccacaatttgatgtatcagagccatttatga

DBGET integrated database retrieval system