KEGG   Bos taurus (cow): 280958Help
Entry
280958            CDS       T01008                                 

Gene name
VWF
Definition
(RefSeq) von Willebrand factor
  KO
K03900  
von Willebrand factor
Organism
bta  Bos taurus (cow)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Complement and coagulation cascades
Platelet activation
Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    280958 (VWF)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    280958 (VWF)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    280958 (VWF)
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    280958 (VWF)
   04611 Platelet activation
    280958 (VWF)
 Human Diseases
  Infectious diseases
   05165 Human papillomavirus infection
    280958 (VWF)
Chaperones and folding catalysts [BR:bta03110]
 Intramolecular chaperones
  Others
   280958 (VWF)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   280958 (VWF)
Cell adhesion molecules and their ligands [BR:bta04516]
 2. Integrin Family
  Beta1 integrins
   VLA-4
    ITGB1; integrin beta 1 [KO:K05719]
     280958 (VWF)
   VLA-9
     280958 (VWF)
  Beta3 integrins
   alpha IIb  beta 3
    ITGB3; integrin beta 3 [KO:K06493]
     280958 (VWF)
   VNR
     280958 (VWF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
5q35
AA seq 2809 aa AA seqDB search
MFPTRLARLLLAVALTLPGALCGEGALGKSSMARCSLFGADFINTFDESMYSFSGDCSYL
LAGDCKTHSFSIVGDFQGGRRMGLSVYLGEFFDIHVFVNGTVLQGGQHVSMPYATRGLYL
ETEVGHHKLSSESYGFVARIDGSGNFQILLSDRHFNKTCGLCGDFNIFAEDDFRTQGTLT
SDPYDFANSWALSSEEQRCPRVSPPSSSCNVSSELQKGLWEKCQLLKTASVFARCHALVD
PEPFVALCERMLCACAQGLRCPCPVLLEYARACAKQGMLLYGWADHSSCRPDCPAGMEYK
ECVSPCHRTCRSLSITEVCREQCVDGCSCPEGQLLDEGRCVESTECPCVHAGKPYPPGAS
LSRDCNTCICRNSQWVCSNEDCPGECLITGQSHFKSFDDRHFTFSGVCQYLLAQDCQDHS
FSVVIETVQCADDPDAVCTRSVTVRLPSPHHGLLKLKHGGGVALDGQDIQIPLLQGDLRI
QHTVTASLQLNFGEDLQIDWDGRGRLLLKLSPVYAGRTCGLCGNYNGNQRDDFLTPAGLV
EPLVEHFGNSWKLRADCEDLQEQPSDPCSLNPRLTKFADQACAILTSPKFEACHSAVSPL
PYLRNCRYDVCACSDGRDCLCDAVANYAAACARRGVHVGWREPSFCALSCTHGQVYQQCG
TPCNLTCRSLSHPDEECTEVCLEGCFCPPGLFLDETGSCVPKAQCPCYYDGEIFQPEDIF
SDHHTMCYCEDGFMHCSTSGAPGSLLPEAVLSSPLSHRSKRSLSCRPPMVKVVCPADNPR
AEGLECTKTCQNYDLECMSTGCVSGCLCPPGMVRHENRCVALERCPCFHQGREYAPGDRV
KVDCNSCVCQDRKWNCTDHVCDASCSALGLAHYFTFDGLKYLFPGECQYVLVQDHCGSNP
GTFRVLVGNEGCSVPSLKCRKRITILVEGGEIELFDGEVNVKTPMKDETHFEVVESGRYI
TVLLGKALSVVWDGHLAVSVFLKRTYQERVCGLCGNFDGVQNNDLTSSSLQVEENPVDFG
NSWKVSPQCADTQKVRLDSAPAICHDNVMKQTMVDSSCRVLTSDVFRECNRLVNPEPYLD
VCIYDSCSCESIGDCSCFCDTIAAYAHECAQHGQVVTWRTATLCPQNCEERNLKESGYQC
EWRYNSCAPACPVTCQHPEPLACPVQCVEGCHAHCPPGKILDELLQTCVNPEDCPVCQVE
GRRLASGKKVTLNPGDPEHCQICHCDGVSLTCEACKEPGGPPPTEGPVIPTTPYVEDIPE
PPLHDFFCSKLLDLVFLLDGSSKLSEADFETLKAFVVGMMERLHISQKRIRVAVVEYHDG
SHAYLALQDRKRPSELRRIAGQVKYAGSEVASTSEVLKYTLFQIFGRIDRPEASRVALLL
TASQEPPRLARNLVRYVQGLKKKKVSVVPVGIGPHASLKQIRLIEKQAPENKAFVLSGVH
ELEQRMDDIVGYLCDLALEVPAPTLTQHPLAAQVTVAPQLLGPSLPGPKRSSVVLDVAFL
LEGSDEVGEANFNRSAEFVEEVIRRMDVGQDGIHVTVLQYSYVVTVEHSFREPQSKDVVL
QRLREVRYRGGNQTNTGLALQYLSEHSFSASQGDREQAPNLVYMVTGSPASDKIQRMPGD
IQLVPIGVGPRVDVQELERVSWPQTPIFIQDFERLPREAPDLVLQRCCSEDGPHLPTLAP
APDCSQPLDVVLLLDGSSTSPASYFDEMKSFAKAFISKANLGPQLTQVSVLQYGSNTNVD
VPWDIHVDKAHLLSLVDPMHREGGPSQVGNALSFAARYITSQVHGARPSASKVVVILVTG
SSMDSVEAAAAAARSNRVAVFPIGIGDQYDAAQLRVLAGPGASSNVAELQRIEDLPSMVA
LGNSFFQRLCSGFVSVCVDEDGNERRPGDVWTLLDQCHTVTCLPDGQTLLKSHRVNCDQG
PQPSCPDGQTPLRMEEACGCRWACPCVCTGSSTRHIVTFDGRNFKLTGNCSYVLFHNKEQ
DLEVILHNGFCSAGARQACMKSVEVKQNGLSVELRSNMEVMVNGRLVSVPYLGGDMEVRV
YGTIMFEVRFMGHILSFTPQNNEFQLQLRPKIFASKTYGLCGFCDENGANDFMLRDGTVT
EDWKTLVREWTVQQPGQTCPLGPEEPCPISQGSRCQVLLSELFAECHKVLAPATFHAMCQ
QDSCQQEQVCEAIASYAHLCRTKGVCVDWRTPDFCAVSCPPSLIYNHCESGCPRQCEGNS
SSCGDHPLEGCFCPPHQVMLEGSCVPEEACTQCVGDDGIRHQLLETWVPDHQPCQICTCL
SGRKVNCTTQPCPSAGVPTCGPCEVARLRQSTQQCCPEYECVCDLVSCDVPPVPNCEDGL
QPVLANPGECRPSFTCVCRKEECPKGSPPSCPPHRMPALRKTRCCDEYECACNCTNSTVS
CPLGYLASTITNDCSCTTTTCLPDKVCVHRGTIYPVGQFWEEGCDTCTCTDLEDAVMGLR
VAQCSQKPCADICRPGFTYVLREGECCGRCLPSACEVVTGSPRGDSQTQWKSVGSHWASP
ENPCLIHECVRVEEEVFVQQRNVSCPQLNVPVCPLGFQLRCQTLGCCPTCRCEPVQACVL
NGTIIGPGKTVMVDACMTCRCHVQAGVISGFKLECRKTTCQACPAGYMEEKLQGECCGRC
LPTACTIQLRGGQIMMLKRDETLQDGCDSHFCKVNKRGEFIWEKRVMSCPPFNEHKCLAE
GGEIMKIPGTCCDTCEEPECKDITARVKSIKVGDCKSEDEVDIHYCQGRCTSKALYSIDT
EDVQDQCSCCSPTRTEPMPVPLRCTNGSIIHHVVLNALQCQCSSRKCSP
NT seq 8430 nt NT seq  +upstreamnt  +downstreamnt
atgtttcccaccaggctcgcgaggctgctgcttgctgtggccctcactttgccaggggcc
ctttgtggagaaggggctcttggcaagtcatcgatggcccggtgcagcctcttcggagct
gacttcatcaacacctttgatgagagcatgtacagcttctcgggagactgcagttacctc
ctggcaggggattgcaagacacactccttctcaatcgtaggggacttccaaggtggtaga
agaatgggtctctcggtgtacctaggggaatttttcgacatccatgtgtttgtcaacggt
accgtgctgcaggggggccagcacgtctccatgccctatgccaccagagggctatacctg
gagaccgaggttgggcaccacaagctgtccagcgagtcgtatggctttgtggccaggatc
gacggcagcgggaacttccaaatcctgctgtcggacagacacttcaacaagacctgtggg
ctgtgcggtgactttaacatctttgccgaagatgacttcaggactcaaggaaccctgacc
tcagacccgtacgactttgcaaactcctgggccctgagcagtgaggagcagcggtgccca
cgggtgtcccctcccagcagctcctgcaacgtctcctccgagctgcagaagggcctgtgg
gagaagtgccagcttctgaagacggcctccgtgttcgcccgctgccacgccctggtggac
cccgagccttttgtggccctgtgtgagcggatgctgtgcgcatgcgcccaggggctgcgg
tgcccctgccctgtgctcctggagtacgcccgcgcctgcgccaagcaggggatgctgctg
tacggctgggcggaccacagctcctgccgaccagactgccccgcgggcatggagtacaag
gagtgtgtgtccccatgccacaggacctgccggagcctgagtatcaccgaagtgtgtcgg
gagcagtgtgtggatggctgcagctgccctgagggacagctcctggatgaaggccgctgt
gtggaaagtactgagtgtccctgtgtgcatgctggaaagccataccctccaggagcctcc
ctctcacgagactgcaacacctgcatctgccgaaacagccagtgggtctgcagcaatgag
gactgtccaggagagtgtctcatcacaggacaatcccacttcaagagctttgacgacagg
cacttcaccttcagcggggtctgccagtacctgctggcccaggactgccaggatcactcc
ttctccgtcgtcatagagactgtccagtgtgccgacgaccctgatgcggtctgcacccgc
tccgtcaccgtccgcctgcccagcccgcaccacggcctcctgaagctgaagcacgggggt
ggagtcgccctggacggccaggatatccagattcccctcctgcaaggtgacctccgcatc
cagcacactgtgacggcctccctgcagctcaacttcggggaggacctgcagatagactgg
gacggccgtgggaggctgctgctgaagctgtcccctgtctacgcggggaggacatgcggg
ctgtgcgggaattacaacggcaaccagagggacgacttcctgacgcccgcgggcctggtc
gagcccctggtggagcacttcggaaactcctggaagctgcgcgcagactgtgaggacttg
caggagcagcccagtgacccctgcagcctcaatccgcgcctgaccaagttcgcagaccag
gcctgcgccatcctgacgtcccccaagttcgaggcctgccacagcgccgtgagcccgctg
ccctacctgcgcaactgccgctacgacgtgtgcgcctgctccgacggcagagactgcctg
tgcgacgcggtggccaactacgcagcggcctgcgcccggaggggcgtgcacgtcggatgg
cgggagcccagcttctgtgcgctgagctgcacacacggccaggtgtaccagcagtgtggg
accccctgcaacctcacctgccgctcactctcccacccggacgaggaatgcaccgaggtc
tgtctggagggctgcttctgcccgccagggctcttcctggacgagacagggtcctgtgtg
cccaaggcccagtgcccctgttactacgacggtgagatcttccaacccgaagacatcttc
tcggaccatcacaccatgtgctactgcgaagatggcttcatgcactgctccacgagtgga
gccccagggagcctgctgcctgaagcagtcctcagcagccccctgtcccaccgcagcaaa
aggagcctgtcctgccggccccccatggtcaaggtggtgtgccctgctgacaacccgagg
gccgaagggcttgaatgcaccaaaacctgccagaactatgacctggaatgcatgagcact
ggctgtgtgtccggctgcctctgccccccgggcatggtccggcatgagaacaggtgtgtg
gccctggaaaggtgcccttgcttccaccagggcagagagtatgcccccggagacagggtg
aaggtcgattgcaacagctgcgtctgtcaggaccggaagtggaactgtacggaccacgtg
tgtgatgctagctgctctgccctgggcctggctcactacttcacctttgatgggctcaag
tacctgttcccgggggagtgccagtatgtcctggtgcaggaccactgtggtagtaacccc
ggcaccttccgggtcctggtggggaatgaggggtgcagcgtcccctccctgaagtgcagg
aagcgcatcaccatcctggtggaaggaggagaaatagagctgtttgacggggaggtgaac
gtgaagacgcccatgaaggatgagacacactttgaggtggtggagtctggccggtacatc
actgtgctgctgggcaaggccctctctgtggtctgggacgggcacctggccgtctccgtg
ttcctgaagcggacgtaccaggagcgggtatgcggcctgtgtgggaatttcgatggcgtc
cagaacaatgacctcaccagcagcagcctccaagtggaggaaaaccccgtggactttggg
aattcctggaaagtgagcccacagtgtgctgacacccagaaagtgcggctggactcggcc
cctgccatctgccatgacaacgtcatgaagcagaccatggtggattcctcctgcagggtc
ctcaccagtgatgttttccgagagtgcaacaggctggtgaaccccgagccgtacctggat
gtttgcatctatgacagctgctcctgcgagtccatcggggactgctcctgcttctgtgac
accatcgctgcctatgcccatgagtgtgcccagcacggccaggtggtgacctggaggaca
gccacactgtgcccccagaattgtgaggagcggaacctgaaggagagtgggtaccaatgc
gagtggcgctacaacagctgtgctccggcctgtccagtcacgtgccagcacccggagccc
ctggcctgccccgtgcagtgcgtggagggctgccacgcacactgcccacccgggaaaatc
ctggacgagcttttgcagacctgcgtcaaccccgaggactgccctgtgtgccaggtggag
ggccggcgcttagcctccgggaagaaagtgaccctgaaccctggggaccctgagcattgc
cagatctgtcactgtgatggtgtcagcctcacttgtgaagcctgcaaggagccaggaggc
ccgccccccaccgaaggcccggtcatccccacaaccccatatgtggaggacatcccggag
ccgcccctgcatgacttcttctgcagcaaactcctggacctggtcttcctgctggatggc
tcctccaagctgtccgaggctgacttcgagacgctgaaggcattcgtggtgggcatgatg
gagcgtctgcacatttcccagaaacgcatccgtgtggccgtggtggagtaccatgatggc
tcccatgcctacctcgcgctgcaagaccggaaacggccatctgagcttcggcgcattgcc
gggcaggtgaagtatgcgggcagcgaggtggcttccaccagcgaggtcttgaagtacacg
ctcttccagatcttcggcaggattgaccggcctgaggcctctcgcgtggccctgctgctt
acggccagccaggaaccccccaggctggcccggaacttggtccgctacgtccagggcctg
aagaagaagaaggtctccgtggtccccgtgggcatcgggccccacgccagcctcaagcag
atccgcctcattgagaagcaggcacctgagaacaaagcctttgtgctaagtggcgtgcac
gagctggagcagcggatggacgatattgtcggctacctctgcgacctcgccctcgaggtg
cctgccccgaccctgacgcaacatcccctcgccgcacaggtcactgtggcgccgcagctc
ctgggtccttcgctgccgggacccaagaggagctctgtggtcctggatgtggcattcctc
ctggaaggctcggacgaggtgggcgaggccaacttcaacaggagcgcagagtttgtggag
gaggtgatccgacgcatggacgtgggccaggacggcatccacgtcacagtgctgcagtac
tcatatgtggtgactgtggagcactccttcagggagccacagtccaaggacgtggtcctg
cagcgactccgtgaagtccgctaccgaggtggcaaccagacaaacacggggctggccctg
cagtacttgtcggagcacagcttctctgccagccagggggaccgggagcaggcgcccaac
ctggtctacatggtgacaggaagcccggcctcggacaagatccagcggatgcctggagac
atccagctggtgcccatcggcgtgggcccccgcgtggatgtgcaggagctggagagggtc
agctggccccagacccccatcttcatccaggacttcgagaggctcccccgagaagctcca
gatctggtgctgcagcggtgctgctccgaagacggcccgcacctccccaccctcgcccct
gccccagactgcagccagcccctggatgtagttctcctcctggatggctcctccacctct
ccagcctcttactttgacgaaatgaagagtttcgccaaggcgttcatctcaaaagccaac
ctaggccctcagctcacccaggtgtcggtcctgcagtacggaagcaacaccaacgttgac
gtgccctgggacatacacgtggacaaagcccacctgctgagccttgtggaccccatgcat
cgcgagggaggccccagccaagttggtaacgcactgtccttcgcggcacgctacatcacg
tcccaagtccacggtgccaggcccagtgcctccaaggtggtggtgatcctggtcacaggc
tcctccatggattcagtggaggcggccgccgctgctgccagatccaaccgagtggctgtg
ttccccatcgggattggggaccagtatgatgcagcccagctgagggtcttggcgggtccg
ggggccagctccaacgtggcagagctccagcggatcgaagacctccccagcatggttgcc
cttggcaactctttcttccagaggctatgctctgggttcgtcagtgtttgcgtggatgag
gacgggaatgagaggaggcctggggacgtctggaccttgctggatcagtgccacacggtg
acttgcctgccagatggccagaccttgctgaagagtcaccgggtcaactgcgatcagggg
ccacagccatcatgccccgacggccagaccccgctcaggatggaggaagcctgtggctgc
cgctgggcctgtccctgtgtgtgcacaggcagctccactcggcacatcgtgacctttgat
ggacggaatttcaagctgaccggcaactgctcatatgttctgtttcacaacaaggagcag
gacttggaggtgattctccataatggattctgcagcgctggggcgaggcaggcctgcatg
aaatctgtggaggtgaagcagaacggcctctcggttgagctccgcagcaacatggaggtg
atggtgaatgggagactggtctctgtcccttacctgggtggggacatggaggtcagagtc
tatggtaccatcatgttcgaggtcagattcatgggccacatcctctccttcaccccacaa
aacaacgagttccagctgcagctgaggcccaagatctttgcctcaaagacgtatggtctc
tgtgggttctgtgatgagaacggggccaatgacttcatgctgagggatggcacggtcact
gaggactggaagacactggtccgggagtggacggtgcagcagccggggcagacatgcccg
ctgggccccgaggagccgtgccccatctcccagggctcccgctgccaggtcctcctctct
gagctatttgctgagtgccacaaggtccttgctccagccacatttcatgccatgtgccag
caggacagttgccagcaggagcaagtgtgtgaagccattgcctcttatgcccacctctgc
cggaccaagggggtgtgtgtcgactggaggactcctgatttctgtgctgtgtcctgcccg
ccctccctgatctacaaccactgtgagagtggctgcccccggcagtgtgagggcaactcg
agctcctgcggggaccatcccttggaaggctgcttctgccctccgcaccaagtgatgctg
gaaggcagctgtgtccctgaggaggcctgtacccagtgcgtcggtgacgatggcatccgg
caccagctcctggaaacgtgggtcccagaccatcagccctgccagatctgcacgtgcctc
agcgggcggaaggtcaactgcacgacacagccctgcccctcggccggagtgcccacgtgc
ggcccatgtgaggtggcccggctccggcagagcacgcagcagtgctgtcccgagtacgag
tgtgtgtgtgacttggtgagctgtgacgtgcccccggtgcctaactgcgaagacggcctc
cagccggtgctggccaatcctggcgagtgcagacccagcttcacctgtgtctgcaggaag
gaggaatgcccgaaggggtccccaccctcctgccccccgcaccggatgcccgcccttcgg
aagacccggtgctgtgacgagtacgagtgtgcttgcaactgcaccaactccacggtgagc
tgcccgctggggtacctggcctccaccatcaccaacgactgcagctgcaccaccaccacc
tgcctccccgacaaggtgtgcgtccaccgaggcaccatctaccccgtgggccagttctgg
gaggagggctgtgatacctgcacctgcacggatctggaggatgctgtgatgggcctgcgc
gtggcccagtgctcccagaaaccctgcgcggacatctgccggccgggcttcacctacgtc
ctccgcgagggagagtgctgtggaaggtgcctgccgtcggcctgcgaggtggtgaccggc
tccccgcggggggactcccagacccagtggaagagtgttggctctcactgggcctccccc
gagaacccctgcctcatccacgagtgcgtccgagtcgaggaggaggtcttcgtgcagcag
aggaatgtctcctgcccgcagctgaatgtccccgtctgcccgttgggcttccagctgcgc
tgtcagaccttgggctgttgccccacctgtcgctgcgagcccgtgcaggcttgcgtcctc
aacggcaccatcatcgggcccgggaagactgtgatggttgacgcatgcatgacctgccgc
tgccacgtccaggcaggggtcatctctggattcaagctggagtgcaggaagaccacctgc
caggcctgccctgcgggttacatggaagagaagctccagggcgaatgctgtgggagatgc
ctgcctacggcgtgcaccattcagctacgagggggacagatcatgatgctgaagcgtgat
gagacactccaggatggctgtgacagtcacttctgcaaagtcaacaagagaggagagttc
atttgggagaagagggtcatgagctgcccgcccttcaacgaacacaaatgcctggctgag
gggggggaaatcatgaaaatccctggcacgtgctgtgacacatgtgaggagcctgagtgc
aaggacatcacagccagggtgaagtccatcaaggtgggagactgcaaatctgaagatgaa
gtggacattcactactgccagggaagatgcaccagcaaagccctgtactccatcgacacg
gaggatgtgcaggaccagtgttcctgctgctcgccgacgcgcacggagcccatgccagtg
cccctgcgctgcaccaacggctccatcatccaccatgtggtcctcaacgccctgcagtgc
cagtgctcctccaggaaatgcagcccgtga

DBGET integrated database retrieval system