KEGG   Bos taurus (cow): 280994Help
Entry
280994            CDS       T01008                                 

Gene name
ALPL, TNS-AP
Definition
alkaline phosphatase, liver/bone/kidney (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
bta  Bos taurus (cow)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bta00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
2
AA seq 524 aa AA seqDB search
MISPFLLLAIGTCFASSLVPEKEKDPKYWRDQAQQTLKNALRLQTLNTNVAKNVIMFLGD
GMGVSTVTAARILKGQLHHSPGEETKLEMDKFPYVALSKTYNTNAQVPDSAGTATAYLCG
VKANEGTVGVSAATQRSQCNTTQGNEVTSILRWAKDAGKSVGIVTTTRVNHATPSASYAH
SADRDWYSDNEMPPEALSQGCKDIAYQLMHNIKDIEVIMGGGRKYMFPKNRTDVEYELDE
KARGTRLDGLNLIDIWKSFKPKHKHSHYVWNRTDLLALDPHSVDYLLGLFEPGDMQYELN
RNNATDPSLSEMVEMAIRILNKNPKGFFLLVEGGRIDHGHHEGKAKQALHEAVEMDQAIG
QAGAMTSVEDTLTVVTADHSHVFTFGGYTPRGNSIFGLAPMVSDTDKKPFTAILYGNGPG
YKVVGGERENVSMVDYAHNNYQAQSAVPLRHETHGGEDVAVFAKGPMAHLLHGVHEQNYI
PHVMAYAACIGANRDHCASASSSGSPSPGPLLLLLALLPLGSLF
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgatttcaccattcttactgctggctatcggtacctgttttgccagctccttagtgcca
gagaaagagaaagatcccaagtactggcgagaccaagctcagcagaccctgaaaaatgca
ctgaggcttcagactctcaacaccaacgtggctaagaacgtcatcatgttcctgggagac
ggtatgggcgtgtccaccgtgacagctgcccgcatcctcaaggggcagctccaccacagc
cctggggaggagaccaagctggagatggacaagtttccctacgtggccctctccaagacg
tacaacaccaacgcccaggtccctgatagcgcaggcaccgccaccgcctacttgtgtggg
gtgaaggccaatgagggcacggtgggggtgagcgcagcaacccagcgctcccagtgcaac
accactcagggcaacgaggtcacctccatcctgcgctgggccaaggacgcagggaaatcc
gtgggcatcgtgaccaccacgcgcgtgaaccacgccacccccagcgcctcctacgcccac
tctgctgaccgggactggtactcggacaacgagatgcccccggaggccctgagccagggc
tgcaaggacatcgcctaccagctcatgcacaacattaaggacatcgaggtgatcatgggc
ggcggccggaagtacatgttccccaagaacagaaccgatgtggagtatgagctggatgag
aaggccagaggcacgaggctggacggcctgaacctcatcgacatctggaagagcttcaaa
ccgaaacacaagcactctcactatgtctggaaccgcactgatctcctggcccttgacccc
cacagcgtggactacctcttgggtctctttgagccgggggacatgcagtacgaactcaac
aggaacaatgcgactgacccttcactctctgagatggtagagatggccatcaggatcctg
aacaagaaccccaaaggcttcttcctgctggtggaagggggcaggattgaccacgggcac
cacgagggcaaagccaagcaggcactgcacgaggcggtggagatggaccaggccatcggg
caggcaggtgctatgacctccgtagaagacacactgaccgttgtcaccgctgaccactcc
cacgtctttacctttggcgggtacaccccccgtggcaactcgatctttggtctggccccc
atggtgagtgacacagacaagaagccgttcaccgccatcctgtacggcaacgggcctggc
tacaaggtggtgggtggtgagcgagagaatgtctccatggtggactacgctcacaataac
taccaggcgcagtccgcagtgcccctgcgccacgagacccacggcggcgaggacgtggcc
gtctttgccaagggccccatggcgcacctgctgcacggcgtccacgagcagaactacatc
ccccacgtgatggcctacgcagcctgcattggtgccaaccgcgaccactgtgcctcagcc
agctcgtccggcagcccctcccccggccccctgctgctcctcctggccctgctgcccctg
ggcagcctgttctga

DBGET integrated database retrieval system