KEGG   Bos taurus (cow): 281039Help
Entry
281039            CDS       T01008                                 

Gene name
CAST
Definition
(RefSeq) calpastatin
  KO
K04281  
calpastatin
Organism
bta  Bos taurus (cow)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
7
AA seq 799 aa AA seqDB search
MSQPGPKPAASPRPRRAARHTQEHVSRKTSGSPSKSGEKKGSDEKKATSLGSSQLSRTQA
DEKALVPKVTTSSASASKSSSMNPTEAKAIPGSKQLEGPHSPNKKRHKKQAVKTEPEKKP
QSSKPSVVHEKKTQEVKPKEHTEPKSLPKHSSDTGSKHAPKEKAVSKSSEQPPSEKSTKP
KTKSQDKISGGGKSTVPAAAAAASAEPADKNKENKLLTSAVPAESKPSKPSGKSDMDTAL
DDLIDTLGEPEEMKEDNTTYTGPEVSDPMSSTYIEELGKRESTLPPKYKELLNKEEGIAG
PPPDSLKPLGPNDAIDALSSDFTCSSPTADAKKTEKEKSTEEALKAQSAGVIRSAAPPQE
KKRKVEKDAMTEHALEALSASLGTRKPEPELDPSSIKEVDEAKAKEEKVKKCGEDEETVP
SEYRLKPATDKDGKPLLPEAEEKPKPLSESELIDELSEDFDQSKCKEKQSKPTEKTEASP
AAAPVPVAEDVPRTSMCSVQSAPPTAAPVKGMVPDDAVEALAGSLGKKEADPEDGKPVED
KVKEKAKEEDREKLGEKEETIPPDYRLEEAKDKDGKPLLPKEVKEPLPPLSEDVLLDALS
KDFTVPSDTSSPQFEDAKLSAVVSEVVSQTPAPTTQAAGPPPSTAQRDNKELDDALDQLS
DSLGQRQPDPDENKPVEDKVKEKAKAEHRDKLGERDDTIPPKYQHLLDDNKEGTPGKPKA
SEKPKASEKPAGAQDPIDALSGDFDSCPSTTETSTDTPKDKDKKPASSAEAPRNGGKAKD
STKAKEETSKPKADGKSTS
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagccgggcccgaagcccgccgcctccccgcggccccggcgcgctgcccgccac
acccaggagcatgtcagtagaaaaaccagtggatcgccttccaagtcaggagaaaagaaa
ggatcagatgagaaaaaagcaacaagccttgggagcagtcagctctccagaactcaggct
gatgaaaaagccctggtccccaaggtaactacttcctctgcgtcagccagcaagtcttcc
agtatgaatcccacagaagccaaggctattccaggcagcaaacagctggaaggaccgcat
tctcctaacaagaaaagacacaaaaaacaggctgtaaaaacagaacctgagaagaagcca
caatcatctaagccatctgtggttcatgagaaaaaaacccaagaagtaaagccaaaggaa
cacacagagccaaaaagcctacccaagcactcatcagatacaggaagcaagcatgctcct
aaggaaaaagccgtttccaaatcaagtgagcagccaccatcagagaaatcaacaaaacca
aagaccaagtcacaggacaagatctccggtggtggaaagagcactgttcctgctgctgct
gctgcagcatctgccgaaccagctgacaagaataaagaaaataaattgttaacatcggcc
gtaccagctgaatctaaaccaagtaaaccatctggaaagtcagacatggacactgctctg
gatgacttaatagacactttaggagaacctgaagagatgaaagaagataacacaacatat
accggaccggaagtgtcggatccaatgagttctacctacatagaggaactgggtaaaaga
gaatccacacttcctccaaaatataaggaacttctgaataaagaagaagggatcgcaggg
cctcctccagactccttgaaacccctggggcccaatgatgccatcgatgccttgtcatcc
gacttcacctgcagttcccctacagctgatgcaaagaaaactgagaaagagaaatctaca
gaagaggctttaaaagctcagtcagctggggtgatcagaagtgctgctccaccccaagag
aaaaaaaggaaagtggaaaaggatgccatgactgagcacgccctggaggccctgtcagcc
tccctgggcacccggaagccggagccggagctcgaccccagctccattaaggaggtcgat
gaggcaaaagccaaagaagagaaagtaaagaaatgtggtgaagatgaggaaacagtccca
tcggagtacagattaaaaccggccacagataaagatggaaaaccactcttgccagaggct
gaagaaaaacccaagcccctgagtgaatcagaactcatcgatgaactctcagaagatttt
gaccagtctaagtgtaaagaaaaacaatctaagccaactgaaaaaacagaggcatccccg
gccgctgcccctgtacccgtggcagaggacgtgcctcggacctctatgtgttccgtgcag
tcggctccgcccacagcagctccagtgaagggcatggtgccagacgatgctgttgaagcc
ttggctggaagcctgggcaaaaaggaagcagatccagaagacggaaagcctgtggaggat
aaagtcaaggaaaaagccaaagaagaggatcgtgagaaacttggtgaaaaagaagaaacg
attcctcctgattacagattagaagaagccaaggataaagacggaaaaccactgctgcca
aaagaggtcaaggaaccgctcccacccttgagtgaagacgtcctcctcgatgctctgtcc
aaggacttcactgtcccctcagacacatcatcgcctcaatttgaagatgctaaactttca
gctgtcgtctctgaagtggtttcccaaaccccagctccaaccacccaggcagccggtcca
ccccccagcactgcgcagcgtgacaacaaagaacttgacgatgccctggatcaactttct
gacagtctcgggcaaagacagcctgatccagatgagaataaacccgtagaggataaagtc
aaggaaaaagccaaagctgaacacagagacaagctgggagaaagagatgacaccatccca
cctaaataccaacatcttttggatgacaacaaggagggcacacccgggaagccaaaggca
tcagagaagcccaaggcatcagagaaacctgcaggtgcccaggaccccattgatgccctc
tcaggggactttgacagctgtccctcgactacagaaacctcgacagacacaccaaaggac
aaagacaagaagcctgcttccagtgccgaagcacctaggaatggcgggaaagcaaaggat
tccacaaaggcaaaggaggaaacttccaagccaaaagctgatggaaaaagtacaagttaa

DBGET integrated database retrieval system