KEGG   Bos taurus (cow): 281043Help
Entry
281043            CDS       T01008                                 

Gene name
CCL2, MCP-1, MCP-1A, MCP1, MCP1A, SCYA2
Definition
chemokine (C-C motif) ligand 2
Orthology
K14624  
C-C motif chemokine 2
Organism
bta  Bos taurus (cow)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
NOD-like receptor signaling pathway
TNF signaling pathway
Chagas disease (American trypanosomiasis)
Malaria
Influenza A
Herpes simplex infection
Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    281043 (CCL2)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    281043 (CCL2)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    281043 (CCL2)
   04062 Chemokine signaling pathway
    281043 (CCL2)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    281043 (CCL2)
  Infectious diseases
   05164 Influenza A
    281043 (CCL2)
   05168 Herpes simplex infection
    281043 (CCL2)
   05144 Malaria
    281043 (CCL2)
   05142 Chagas disease (American trypanosomiasis)
    281043 (CCL2)
Heparan sulfate/heparin binding proteins [BR:bta00536]
 Chemokines (General comment) Chemokine presentation, transcellular transport, signal transduction
  281043 (CCL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
19
AA seq 99 aa AA seqDB search
MKVSAALLCLLLTVAAFSTEVLAQPDAINSQVACCYTFNSKKISMQRLMNYRRVTSSKCP
KEAVIFKTILGKELCADPKQKWVQDSINYLNKKNQTPKP
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtctccgctgccctcctgtgcctgctactcacagtagctgccttcagcaccgag
gtgctcgctcagccagatgcaattaactcccaagtcgcctgctgctatacattcaacagt
aagaagatctccatgcagaggctgatgaactacagaagagtcaccagcagcaagtgtcct
aaagaggctgtgattttcaagaccatcctgggcaaggagttatgtgcagaccccaagcag
aaatgggtccaggactccataaactatcttaacaagaaaaaccaaactccaaagccttga

DBGET integrated database retrieval system