KEGG   Bos taurus (cow): 281043Help
Entry
281043            CDS       T01008                                 

Gene name
CCL2, MCP-1, MCP-1A, MCP1, MCP1A, SCYA2
Definition
(RefSeq) chemokine (C-C motif) ligand 2
  KO
K14624  
C-C motif chemokine 2
Organism
bta  Bos taurus (cow)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
NOD-like receptor signaling pathway
IL-17 signaling pathway
TNF signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Chagas disease (American trypanosomiasis)
Malaria
Influenza A
Herpes simplex infection
Rheumatoid arthritis
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    281043 (CCL2)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    281043 (CCL2)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    281043 (CCL2)
   04657 IL-17 signaling pathway
    281043 (CCL2)
   04062 Chemokine signaling pathway
    281043 (CCL2)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    281043 (CCL2)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    281043 (CCL2)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    281043 (CCL2)
  Infectious diseases
   05164 Influenza A
    281043 (CCL2)
   05168 Herpes simplex infection
    281043 (CCL2)
   05144 Malaria
    281043 (CCL2)
   05142 Chagas disease (American trypanosomiasis)
    281043 (CCL2)
Cytokines [BR:bta04052]
 Chemokines
  CC chemokine family
   281043 (CCL2)
Glycosaminoglycan binding proteins [BR:bta00536]
 Heparan sulfate/Haparin
  Chemokines (General comment) Chemokine presentation, transcellular transport, signal transduction
   281043 (CCL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
19
AA seq 99 aa AA seqDB search
MKVSAALLCLLLTVAAFSTEVLAQPDAINSQVACCYTFNSKKISMQRLMNYRRVTSSKCP
KEAVIFKTILGKELCADPKQKWVQDSINYLNKKNQTPKP
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtctccgctgccctcctgtgcctgctactcacagtagctgccttcagcaccgag
gtgctcgctcagccagatgcaattaactcccaagtcgcctgctgctatacattcaacagt
aagaagatctccatgcagaggctgatgaactacagaagagtcaccagcagcaagtgtcct
aaagaggctgtgattttcaagaccatcctgggcaaggagttatgtgcagaccccaagcag
aaatgggtccaggactccataaactatcttaacaagaaaaaccaaactccaaagccttga

DBGET integrated database retrieval system