KEGG   Bos taurus (cow): 281043Help
Entry
281043            CDS       T01008                                 

Gene name
CCL2, MCP-1, MCP-1A, MCP1, MCP1A, SCYA2
Definition
chemokine (C-C motif) ligand 2
Orthology
K14624  
C-C motif chemokine 2
Organism
bta  Bos taurus (cow)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
NOD-like receptor signaling pathway
TNF signaling pathway
Chagas disease (American trypanosomiasis)
Malaria
Influenza A
Herpes simplex infection
Rheumatoid arthritis
Class
Environmental Information Processing; Signal transduction; TNF signaling pathway [PATH:bta04668]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:bta04060]
Organismal Systems; Immune system; NOD-like receptor signaling pathway [PATH:bta04621]
Organismal Systems; Immune system; Chemokine signaling pathway [PATH:bta04062]
Human Diseases; Immune diseases; Rheumatoid arthritis [PATH:bta05323]
Human Diseases; Infectious diseases; Influenza A [PATH:bta05164]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:bta05168]
Human Diseases; Infectious diseases; Malaria [PATH:bta05144]
Human Diseases; Infectious diseases; Chagas disease (American trypanosomiasis) [PATH:bta05142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
19
AA seq 99 aa AA seqDB search
MKVSAALLCLLLTVAAFSTEVLAQPDAINSQVACCYTFNSKKISMQRLMNYRRVTSSKCP
KEAVIFKTILGKELCADPKQKWVQDSINYLNKKNQTPKP
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtctccgctgccctcctgtgcctgctactcacagtagctgccttcagcaccgag
gtgctcgctcagccagatgcaattaactcccaagtcgcctgctgctatacattcaacagt
aagaagatctccatgcagaggctgatgaactacagaagagtcaccagcagcaagtgtcct
aaagaggctgtgattttcaagaccatcctgggcaaggagttatgtgcagaccccaagcag
aaatgggtccaggactccataaactatcttaacaagaaaaaccaaactccaaagccttga

DBGET integrated database retrieval system