KEGG   Bos taurus (cow): 281088Help
Entry
281088            CDS       T01008                                 

Gene name
COMP
Definition
(RefSeq) cartilage oligomeric matrix protein
  KO
K04659  thrombospondin 2/3/4/5
Organism
bta  Bos taurus (cow)
Pathway
bta04145  Phagosome
bta04151  PI3K-Akt signaling pathway
bta04510  Focal adhesion
bta04512  ECM-receptor interaction
bta05144  Malaria
bta05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    281088 (COMP)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    281088 (COMP)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    281088 (COMP)
  Cellular community - eukaryotes
   04510 Focal adhesion
    281088 (COMP)
 Human Diseases
  Infectious diseases
   05165 Human papillomavirus infection
    281088 (COMP)
   05144 Malaria
    281088 (COMP)
Membrane trafficking [BR:bta04131]
 Endocytosis
  Phagocytosis
   Opsonins
    281088 (COMP)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   281088 (COMP)
  Exosomal proteins of colorectal cancer cells
   281088 (COMP)
  Exosomal proteins of bladder cancer cells
   281088 (COMP)
Glycosaminoglycan binding proteins [BR:bta00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   281088 (COMP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TSP_C TSP_3 COMP EGF_CA EGF_3 cEGF EGF_MSP1_1
Motif
Other DBs
NCBI-GeneID: 281088
NCBI-ProteinID: NP_001159989
BGD-bta: BT11103
Ensembl: ENSBTAG00000004630
Position
7
AA seq 756 aa AA seqDB search
MVLAAARVLLLTLAALGASGQGQMPLGGDLGPQMLRELQETNAALQDVRDLLRQQVKEIT
FLKNTVMECDACGMQPARTPKLTVRPLSQCSPGFCFPGVACTETANGARCGPCPEGFTGN
GSHCADVNECTAHPCFPRVRCINTSPGFRCEACPPGFSGPTHEGVGLAFAKANKQVCTDI
NECETGQHNCVPNSVCVNTVGSFQCGPCQPGFVGDQASGCRRRPQRFCPDGTPSPCHEKA
DCVLERDGSRSCVCAVGWAGNGLICGRDTDLDGFPDEKLRCSERQCRKDNCVTVPNSGQE
DVDQDGIGDACDPDADGDGVLNEKDNCPLVRNPDQRNTDGDKWGDACDNCRSQKNDDQND
TDKDGRGDACDDDIHGDRIRNPVDNCPKVPNSDQKDTDGDGVGDACDNCPQKSNADQRDV
DHDFVGDACDSDQDQDGDGHQDSKDNCPTVPNSAQQDSDHDGQGDACDDDDDNDGVPDSR
DNCRLVPNPGQEDMDRDGVGDACQGDFDADKVVDKIDVCPENAEVTLTDFRAFQTVVLDP
EGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTATDDDYAGFIF
GYQDSSSFYVVMWKQMEQTYWQANPFRAVAEPGIQLKAVKSSTGPGEQLRNALWHTGDTA
SQVRLLWKDPRNVGWKDKTSYRWFLQHRPQVGYIRVRFYEGPELVADSNVILDTTMRGGR
LGVFCFSQENIIWANLRYRCNDTIPEDYEAQRLLQA
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atggttctcgccgccgcccgcgttctcttgctcacgctggctgccctcggggcatcaggc
caggggcagatgccgctgggtggggacctgggcccgcagatgctacgcgaactccaggag
accaacgcggccctgcaggacgtacgggacctactgcggcagcaggtcaaggagattacg
ttcctgaaaaacacggtgatggagtgtgacgcgtgcgggatgcaacccgcgcgaaccccc
aaactgacggtacggccgctaagccagtgttcgcccggcttctgcttccccggagtggct
tgtaccgagacagccaacggcgcgcgctgcggaccctgccccgaaggtttcacaggcaac
ggctcgcactgcgccgacgtcaacgagtgcactgcccatccttgcttccctcgcgttcgc
tgcatcaataccagtccgggcttccgctgcgaggcttgcccacctgggttcagcggcccc
acccatgagggcgtggggctggccttcgccaaggccaacaagcaggtttgtacggacatt
aacgagtgtgagaccgggcagcataactgcgtccccaactctgtatgcgtcaataccgtg
ggctccttccagtgtggcccttgccagcccggcttcgtgggcgaccaggcatcaggctgc
cgtcggcggccacagcgcttctgccctgacggcacgcccagcccgtgccacgagaaggcc
gactgcgtcctagagcgtgatgggtcgcgatcttgcgtgtgcgccgtcggctgggctggc
aatgggctcatctgcggccgcgacacagacttagacggctttccggacgagaagctacgc
tgctctgagcgccagtgcagaaaggacaactgcgtgacggtgcccaactcagggcaggag
gatgtggaccaggacggcatcggagacgcctgcgacccggacgccgacggggacggcgtc
ctcaatgagaaggacaactgcccgctcgtgcggaacccagaccagcgaaatacggatggc
gacaagtggggcgatgcgtgcgacaactgtcggtcccagaagaacgacgaccagaatgac
acagataaggacggccgaggcgacgcctgcgacgacgacatacacggcgaccggatccgc
aatccggtggacaactgccccaaggtgcccaactcagatcagaaagacactgatggtgat
ggtgtaggagatgcctgtgacaactgtcctcagaagagcaacgcagaccagagggatgtg
gaccacgacttcgtgggagatgcttgtgacagcgaccaagaccaggatggggatgggcac
caggactcgaaggacaactgccctacagtgcccaacagtgcccagcaggactcagaccac
gatggccagggtgacgcctgcgacgacgatgacgacaatgatggggtccccgacagtagg
gacaactgccgtctagtgcccaacccgggccaggaagacatggaccgcgacggcgtgggt
gacgcgtgccagggcgactttgatgcggacaaggtggtagacaagatcgatgtgtgtccg
gagaacgctgaggtcacactcaccgacttccgggccttccagacggtcgtgctggaccct
gagggcgacgcacagatagaccctaactgggtggtgctcaaccagggtatggagatcgta
cagacgatgaacagcgacccaggcctggctgtgggttacacggccttcaatggcgtggat
ttcgaaggcacgttccacgtgaacactgccacggatgacgactacgctggtttcatcttt
ggctaccaggacagctccagcttctatgtggtcatgtggaagcagatggagcagacgtac
tggcaggcgaaccccttccgtgcggtggcagagcccggcatccagctcaaggccgtgaag
tcctccacaggccctggggagcagcttcggaacgcactgtggcacacaggggacacagcg
tcacaggtgcggctgctgtggaaggatccccggaacgtgggctggaaggacaagacatcc
taccgctggttcctgcagcaccggccccaagtgggctatattagagtgcgattctacgag
ggcccagagctggtggcagacagcaacgtgatcctggatacgaccatgcggggcggtcgt
ctgggggtcttctgcttctcccaggagaacatcatctgggccaacctgcgctaccgctgc
aacgacaccatccccgaggactacgaggcccagaggctgctgcaggcctag

DBGET integrated database retrieval system