KEGG   Bos taurus (cow): 281120Help
Entry
281120            CDS       T01008                                 

Gene name
DNTT
Definition
deoxynucleotidyltransferase, terminal (EC:2.7.7.31)
Orthology
K00977  
DNA nucleotidylexotransferase [EC:2.7.7.31]
Organism
bta  Bos taurus (cow)
Pathway
Non-homologous end-joining
Hematopoietic cell lineage
Class
Genetic Information Processing; Replication and repair; Non-homologous end-joining [PATH:bta03450]
Organismal Systems; Immune system; Hematopoietic cell lineage [PATH:bta04640]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
26
AA seq 520 aa AA seqDB search
MAQQRQHQRLPMDPLCTASSGPRKKRPRQVGASMASPPHDIKFQNLVLFILEKKMGTTRR
NFLMELARRKGFRVENELSDSVTHIVAENNSGSEVLEWLQVQNIRASSQLELLDVSWLIE
SMGAGKPVEITGKHQLVVRTDYSATPNPGFQKTPPLAVKKISQYACQRKTTLNNYNHIFT
DAFEILAENSEFKENEVSYVTFMRAASVLKSLPFTIISMKDTEGIPCLGDKVKCIIEEII
EDGESSEVKAVLNDERYQSFKLFTSVFGVGLKTSEKWFRMGFRSLSKIMSDKTLKFTKMQ
KAGFLYYEDLVSCVTRAEAEAVGVLVKEAVWAFLPDAFVTMTGGFRRGKKIGHDVDFLIT
SPGSAEDEEQLLPKVINLWEKKGLLLYYDLVESTFEKFKLPSRQVDTLDHFQKCFLILKL
HHQRVDSSKSNQQEGKTWKAIRVDLVMCPYENRAFALLGWTGSRQFERDIRRYATHERKM
MLDNHALYDKTKRVFLKAESEEEIFAHLGLDYIEPWERNA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atggcacagcagaggcagcatcagcgtcttcccatggatccgctgtgcacagcctcctca
ggccctcggaagaagagacccaggcaggtgggtgcctcaatggcctcccctcctcatgac
atcaagtttcaaaatttggtcctcttcattttggagaagaaaatgggaaccacccgcaga
aacttcctcatggagctggctcgaaggaaaggtttcagggttgaaaatgagctcagtgat
tctgtcacccacattgtagcagaaaacaactctggttcagaggttctcgagtggcttcag
gtacagaacataagagccagctcgcagctagaactccttgatgtctcctggctgatcgaa
agtatgggagcaggaaaaccagtggagattacaggaaaacaccagcttgttgtgagaaca
gactattcagctaccccaaacccaggcttccagaagactccaccacttgctgtaaaaaag
atctcccagtacgcgtgtcaaagaaaaaccactttgaacaactataaccacatattcacg
gatgcctttgagatactggctgaaaattctgagtttaaagaaaatgaagtctcttatgtg
acatttatgagagcagcttctgtacttaaatctctgccattcacaatcatcagtatgaag
gatacagaaggaattccctgcctgggggacaaggtgaagtgtatcatagaggaaattatt
gaagatggagaaagttctgaagttaaagctgtgttaaatgatgaacgatatcagtccttc
aaactctttacttctgtttttggagtgggactgaagacatctgagaaatggttcaggatg
gggttcagatctctgagtaaaataatgtcagacaaaaccctgaaattcacaaaaatgcag
aaagcaggatttctctattatgaagaccttgtcagctgcgtgaccagggccgaagcagag
gcggttggcgtgctggttaaagaggctgtgtgggcatttctgccggatgcctttgtcacc
atgacaggaggattccgcaggggtaagaagattgggcatgatgtagattttttaattacc
agcccaggatcagcagaggatgaagagcaacttttgcctaaagtgataaacttatgggaa
aaaaagggattacttttatattatgaccttgtggagtcaacatttgaaaagttcaagttg
ccaagcaggcaggtggatactttagatcattttcaaaaatgctttctgattttaaaattg
caccatcagagagtagacagtagcaagtccaaccagcaggaaggaaagacctggaaggcc
atccgtgtggacctggttatgtgcccctacgagaaccgtgcctttgccctgctaggctgg
actggctcccggcagtttgagagagacatccggcgctatgccacacacgagcggaagatg
atgctggataaccacgctttatatgacaagaccaagagggtatttctcaaagcggaaagt
gaagaagaaatctttgcacatctgggattggactacattgaaccatgggaaagaaatgct
tag

DBGET integrated database retrieval system