KEGG   Bos taurus (cow): 281120Help
Entry
281120            CDS       T01008                                 

Gene name
DNTT
Definition
deoxynucleotidyltransferase, terminal (EC:2.7.7.31)
Orthology
K00977  
DNA nucleotidylexotransferase [EC:2.7.7.31]
Organism
bta  Bos taurus (cow)
Pathway
Non-homologous end-joining
Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:bta00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    281120 (DNTT)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    281120 (DNTT)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.31  DNA nucleotidylexotransferase
     281120 (DNTT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
26
AA seq 520 aa AA seqDB search
MAQQRQHQRLPMDPLCTASSGPRKKRPRQVGASMASPPHDIKFQNLVLFILEKKMGTTRR
NFLMELARRKGFRVENELSDSVTHIVAENNSGSEVLEWLQVQNIRASSQLELLDVSWLIE
SMGAGKPVEITGKHQLVVRTDYSATPNPGFQKTPPLAVKKISQYACQRKTTLNNYNHIFT
DAFEILAENSEFKENEVSYVTFMRAASVLKSLPFTIISMKDTEGIPCLGDKVKCIIEEII
EDGESSEVKAVLNDERYQSFKLFTSVFGVGLKTSEKWFRMGFRSLSKIMSDKTLKFTKMQ
KAGFLYYEDLVSCVTRAEAEAVGVLVKEAVWAFLPDAFVTMTGGFRRGKKIGHDVDFLIT
SPGSAEDEEQLLPKVINLWEKKGLLLYYDLVESTFEKFKLPSRQVDTLDHFQKCFLILKL
HHQRVDSSKSNQQEGKTWKAIRVDLVMCPYENRAFALLGWTGSRQFERDIRRYATHERKM
MLDNHALYDKTKRVFLKAESEEEIFAHLGLDYIEPWERNA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atggcacagcagaggcagcatcagcgtcttcccatggatccgctgtgcacagcctcctca
ggccctcggaagaagagacccaggcaggtgggtgcctcaatggcctcccctcctcatgac
atcaagtttcaaaatttggtcctcttcattttggagaagaaaatgggaaccacccgcaga
aacttcctcatggagctggctcgaaggaaaggtttcagggttgaaaatgagctcagtgat
tctgtcacccacattgtagcagaaaacaactctggttcagaggttctcgagtggcttcag
gtacagaacataagagccagctcgcagctagaactccttgatgtctcctggctgatcgaa
agtatgggagcaggaaaaccagtggagattacaggaaaacaccagcttgttgtgagaaca
gactattcagctaccccaaacccaggcttccagaagactccaccacttgctgtaaaaaag
atctcccagtacgcgtgtcaaagaaaaaccactttgaacaactataaccacatattcacg
gatgcctttgagatactggctgaaaattctgagtttaaagaaaatgaagtctcttatgtg
acatttatgagagcagcttctgtacttaaatctctgccattcacaatcatcagtatgaag
gatacagaaggaattccctgcctgggggacaaggtgaagtgtatcatagaggaaattatt
gaagatggagaaagttctgaagttaaagctgtgttaaatgatgaacgatatcagtccttc
aaactctttacttctgtttttggagtgggactgaagacatctgagaaatggttcaggatg
gggttcagatctctgagtaaaataatgtcagacaaaaccctgaaattcacaaaaatgcag
aaagcaggatttctctattatgaagaccttgtcagctgcgtgaccagggccgaagcagag
gcggttggcgtgctggttaaagaggctgtgtgggcatttctgccggatgcctttgtcacc
atgacaggaggattccgcaggggtaagaagattgggcatgatgtagattttttaattacc
agcccaggatcagcagaggatgaagagcaacttttgcctaaagtgataaacttatgggaa
aaaaagggattacttttatattatgaccttgtggagtcaacatttgaaaagttcaagttg
ccaagcaggcaggtggatactttagatcattttcaaaaatgctttctgattttaaaattg
caccatcagagagtagacagtagcaagtccaaccagcaggaaggaaagacctggaaggcc
atccgtgtggacctggttatgtgcccctacgagaaccgtgcctttgccctgctaggctgg
actggctcccggcagtttgagagagacatccggcgctatgccacacacgagcggaagatg
atgctggataaccacgctttatatgacaagaccaagagggtatttctcaaagcggaaagt
gaagaagaaatctttgcacatctgggattggactacattgaaccatgggaaagaaatgct
tag

DBGET integrated database retrieval system