KEGG   Bos taurus (cow): 281165Help
Entry
281165            CDS       T01008                                 

Gene name
FLNA
Definition
filamin A, alpha
Orthology
K04437  
filamin
Organism
bta  Bos taurus (cow)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    281165 (FLNA)
 Cellular Processes
  Cell communication
   04510 Focal adhesion
    281165 (FLNA)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    281165 (FLNA)
  Infectious diseases
   05132 Salmonella infection
    281165 (FLNA)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   281165 (FLNA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
Position
X
AA seq 2647 aa AA seqDB search
MSSSHSRAGQSAAGAVLGIGADTRDAEMPATEKDLAEDAPWKKIQQNTFTRWCNEHLKCV
SKRIANLQTDLSDGLRLIALLEVLSQKKMHRKHNQRPTFRQMQLENVSVALEFLDRESIK
LVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWDEEEDEEAKKQTPKQRLLGWIQNKL
PQLPITNFSRDWQSGRALGALVDSCAPGLCPDWDSWDASKPVNNAREAMQQADDWLGIPQ
VITPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLNPKKARAYGPGIEPTGNMVKK
RAEFTVETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLF
AGQHIAKSPFEVYVDKSQGDASKVTAQGPGLEPSGNIANKTTYFEIFTAGAGMGEVEVVI
QDPAGQKGTVEPQLEARGDSTYRCSYQPSVEGVHMVHVTFAGVPIPRSPYTVTVGQACNP
GACRAVGRGLQPKGVRVKETADFKVYTKGAGSGELKVTVKGPKGEERVKQKDLGDGVYGF
EYYPMIPGTYTVTITWGGQNIGRSPFEVKVGTECGNQKVRAWGPGLEGGVVGKSADFVVE
AIGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFM
ADIRDAPQDFHPDRVKARGPGLEKTGVAVNKSAEFTVDAKHGGKAPLKVQVQDNEGCPVE
ATVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGSHPNKVKVYGPGVA
KTGLKAHEPTYFTVDCTEAGQGDVSIGIKCAPGVVGPAEADIDFDIIRNDNDTFTVKYTP
RGAGSYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLSRTGVELSKPTHFTVNTK
AAGKGKLDVQFSGPAKGDAVRDVDIIDHHDNTYTVKYTPVQQGPVGINVTYGGDAIPKSP
FSVGVSPSLDLSKIKVSGLGEKVDVGKDQEFTVKSKGAGGQGKVLSKIVGPSGAAVPCKV
EPGLGADNSVVRFVPREEGPYEVEVTYDGVPVPGSPFSLEAVPPTKPSKVKAFGPGLQGG
SAGSPARFTIDTKGAGTGGLGLTVEGPCEAQLECLDNGDGTCSVSYVPTEPGDYNINILF
ADTHIPGSPFKAHVVPCFDPSKVKCSGPGLERATAGEAGQFHVDCSSAGSAELTIEIRSE
AGLPAEVHIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAVDTSGIQC
YGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTETYVQDCGDGTYKVE
YTPYEEGLHSVDVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVET
RGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYVPYEAGTYSLNVTYGGHQVPGSPFKV
PVHDVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGMAPLQVKVQGPKGLVEPVDVV
DNADGTQTVNYVPSREGPYSISVLYGDEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGV
PASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVTGRYTILI
KYGGDEIPFSPYRVRAVPTGDASKCTVTVSIGGHGLGAGIGPTIQIGEETVITVDTKAAG
KGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTA
LAGDQPTAQPSLRPQQLAPPYTYAQGGQQTWAPERPLVGVNGLDVSSLRPFDLVIPFTIK
KGEVTGEVRMPSGKVAQPAITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYV
DYVNCGHVTAYGPGLTHGVVNKPAIFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTC
SVSYLPVLPGDYSILVKYNEQHIPGSPFTARVTGDDSMRMSHLKVGSAADIPINISETDL
SLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVIS
QSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDG
TCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGEGRVKESITRRRRAPSVANVGSHC
DLSLKIPEISIQDMTAQVTSPSGKSHEAEIVEGENHTYCIRFVPAEMGMHTVSVKYKGQH
VPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSK
AEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSGDARRLTVSSL
QESGLKVNQPASFAVSLNGAKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGIY
LIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGITGSPAEFIVNTSNAGAG
ALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIAGSPFKARVTGHR
LVSNHSLHETSSVFVDSLTKTATIPQHSAPGPGPTDASKVLAKGVGLSKAYMGQKSSFTV
DCSKAGNNMLLVGVHGPRTPCEEILVKHVGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGS
PYRVLVP
NT seq 7944 nt NT seq  +upstreamnt  +downstreamnt
atgagtagctcccactctcgggcgggccagagcgctgcgggcgcggttctgggcatcggt
gccgacacacgagacgccgagatgccggccaccgagaaggacctggcggaggatgcgccg
tggaagaagatccagcagaacacgttcacgcgctggtgcaacgagcacctcaagtgcgtg
agcaagcgcatcgccaacctgcagacggacctgagcgacgggctgcggcttatcgcgctg
ctcgaggtgctcagccagaagaagatgcaccgcaagcacaaccagaggcccaccttccgc
cagatgcagcttgagaacgtgtcggtggcgctcgagttcctggaccgcgagagcatcaag
ctcgtgtccatcgacagtaaggccatcgtggacgggaacctcaagttgatcctgggcctc
atctggaccctgatcctgcactactccatctccatgcccatgtgggatgaggaggaggac
gaggaggccaagaagcagacccccaagcagaggctgctgggctggatccagaacaagctg
ccacagctgcccatcaccaacttcagccgtgactggcagagcggcagagccctgggcgcc
ctggtcgacagctgtgccccgggcctgtgccccgactgggattcctgggatgccagcaag
cccgtgaacaatgcacgggaagccatgcaacaagctgatgactggctgggcatccctcag
gtgatcacccccgaggagattgtggaccccaacgtggatgagcactccgtcatgacctac
ctgtcccagttccccaaggccaagctgaaaccaggggctcccctgcggcccaaactcaac
ccgaagaaagcccgagcctatgggccaggcattgagcctacaggcaacatggtaaagaag
agggcagagttcacggtggagaccagaagcgccgggcagggagaggtgctggtatacgtg
gaggacccggctgggcaccaggaggaggccaaggtgaccgccaataacgacaagaaccgt
accttctctgtctggtatgtccccgaggtgacggggactcacaaggtcaccgtgctcttt
gccggccagcacattgccaagagccccttcgaggtgtacgtggacaagtcccagggagac
gccagcaaagtgactgcccagggccctggcctggagcccagcggcaacattgccaacaag
accacctactttgagatcttcacggcgggtgcgggcatgggtgaggtggaggtggtgatc
caggacccagcaggccagaagggtaccgtggagcctcagctggaggcccggggcgacagc
acgtatcgctgcagctaccagcccagtgtggagggcgtccacatggtgcacgtcactttc
gccggggtgcccatccctcgcagcccctacacagtcactgtgggtcaagcttgtaaccca
ggtgcctgccgcgctgtcggccggggtctccagcccaagggtgtgcgagtgaaggagacg
gccgacttcaaagtgtacacaaagggggcgggcagcggagagctgaaggtcaccgtaaag
ggccccaagggtgaagagcgtgtgaagcagaaggacctgggcgatggtgtctatggtttc
gagtattaccccatgatccccggcacatacactgtcacgatcacgtggggtggccaaaat
attgggcgcagtcccttcgaggtgaaagtgggcactgagtgcggcaatcagaaggtgcgg
gcatggggccctgggctggagggcggtgttgtcggcaagtctgcagactttgtcgtggag
gccattggcgacgacgtgggcaccctgggcttctcggtggagggcccatcgcaggctaag
atcgagtgtgacgacaagggcgatggctcctgcgatgtgcgctactggccacaggaggct
ggtgagtacgcggtgcacgtgctgtgcaacagtgaggacatccgtctcagccccttcatg
gccgacatccgcgacgcgccccaggatttccatccagacagggtgaaggcacgtgggcct
ggattggagaagaccggcgtggctgtgaacaagtcagcagagttcacagtggatgccaag
cacggcgggaaggctcctctcaaggtccaagtccaggacaatgagggctgcccagtggag
gcaacggtcaaggacaatggcaatggcacttacagctgctcctatgtgccccggaagcca
gtgaagcacacggccatggtgtcctggggaggtgtcagcatccccaacagccccttccgg
gtgaatgtgggtgccggcagccacccgaacaaggtcaaggtgtacggcccaggagtggca
aagacaggactcaaggctcacgagcccacctacttcactgtggactgcacggaggctggc
cagggtgatgtcagcatcggcatcaagtgtgccccgggtgtggtgggccctgccgaggcc
gacatcgacttcgacatcatccgcaacgacaacgacaccttcacggtcaagtacaccccc
cgcggggctggcagctacaccatcatggtgctctttgctgaccaggctacgcccaccagc
cccatccgggtcaaagtggagccttcccatgatgccagcaaggttaaggcagaaggtccc
ggcctcagtcgcaccggggtcgagcttagcaaacccacccacttcacggtcaacaccaaa
gctgccggcaaaggcaagctggatgtccagttctcggggccggccaaaggggatgcagtg
cgtgacgtggacatcattgaccatcatgacaacacctataccgtcaagtacacgcctgtg
cagcagggcccagtgggcatcaatgtcacttacggaggtgatgctattcccaaaagcccc
ttctcagtgggggtgtctccaagcctggacctcagcaagattaaggtgtccggcctggga
gaaaaggtggatgttggcaaagaccaggagttcacggtcaagtccaagggcgccggtggc
cagggcaaagtgctgtcgaagatcgtgggcccttcaggggcagcggttccctgcaaggtg
gagccaggcctcggggctgacaacagcgtggtgcgctttgtgccccgtgaagaggggccc
tatgaggttgaggtgacctatgatggcgtacctgtgcctggcagccccttttccctggaa
gccgtgccgcccaccaagcctagcaaggtgaaagccttcgggccagggctgcaggggggc
agtgcagggtctcctgcccgcttcacgatcgacacaaagggtgccggcacaggcggcctg
ggcctgacggtcgaaggcccttgtgaagctcagctcgaatgcctggacaacggggatggc
acgtgctctgtgtcctatgtgcccactgagcctggggactacaacatcaacatcctcttc
gctgacacccacatccccggctccccattcaaggcccacgtggttccctgcttcgacccg
tccaaggtcaagtgctcaggccccgggctggagcgggccacggctggggaggccggccag
ttccatgtggactgctcgagtgcgggcagtgcggagctgaccatcgagatccgctccgag
gcagggctgccggccgaggtgcacatccaggaccacggtgacggcacgcacaccatcacc
tacatccccctgtgccctggagcctacaccgtcaccatcaagtacggcggccagcctgtg
cccaacttcccaagcaagctgcaggtggagcccgcagtggatacctcgggcatccagtgc
tatgggcccgggattgagggtcaaggtgtcttccgagaagccaccaccgagttcagcgtg
gatgcccgggctctgacgcagactggagggccccacgtcaaggctcgcgtggccaacccc
tcgggcaacctgactgagacctatgtgcaggactgtggtgatggcacatacaaagtggag
tacacaccatatgaggagggactccactctgtggacgtgacctacgacggcagtcctgtg
cccagcagccccttccaggtgccagtgactgaaggctgcgacccctcccgagtgcgtgtc
catgggccaggcatccaaagcggcaccaccaacaagcccaacaagttcactgtggagacc
aggggagctggcacagggggcctgggcttggctgttgagggcccctctgaggccaagatg
tcctgcatggacaacaaggatggcagctgctcggttgagtatgtcccctacgaggccggc
acctacagccttaacgtcacttacggcggccaccaagtgccaggcagtcctttcaaggtc
cctgtgcacgatgtgacagacgcgtccaaggtcaaatgctctgggcctggcctgagcccg
ggcatggtccgtgccaacctacctcagtccttccaggtggacacgagcaaggctggcatg
gccccactgcaggtcaaagtgcaggggcccaaaggcctggtggagccggtggacgtggtg
gacaatgccgatggcacccagactgtgaactatgtgcccagccgtgaggggccctacagc
atctcagtgctgtatggagacgaagaggtaccccgcagccccttcaaggttaaggtgctg
cctacacatgatgccagcaaggtcaaggccagtggcccagggctcaacaccacgggtgtg
cctgccagcctgcctgtggagttcactattgatgccaaggacgctggggagggcctgctg
gctgtccagatcacggacccggagggcaagcccaagaagacacacatccaagacaaccac
gacggcacgtacacagtggcctacgtgccagacgtgacaggccgctacactatcctcata
aagtatggtggtgacgagatccccttctccccataccgtgtccgcgccgtgcccacgggg
gatgccagcaagtgcaccgtcacagtgtcaatcggaggtcacgggctaggtgctggcatc
ggccctaccatccagatcggggaggagactgtgatcactgtggacaccaaggcagcgggc
aaaggcaaggtcacctgtactgtgtgcacccccgatggctctgaggtggacgtggacgtg
gtcgagaatgaggatggcacctttgacatcttctacacggctccccagcccggcaaatac
gtcatctgcgtgcgcttcggtggtgaacacgtgcccaacagtcccttccaagtgacggct
ctggctggagaccagcccacggcacagccctcattacggcctcagcagctggcaccacca
tatacctacgcccaggggggccagcagacctgggccccagaaaggcccctggtgggggtc
aacgggctagatgtgagcagcctgaggccctttgaccttgtcatccccttcaccatcaag
aagggcgaggtcactggggaggtgcggatgccctcgggcaaggtggcacagcccgccatc
accgacaacaaggatggcactgtgactgtgcgctacgcccccagtgaagccggcctgcac
gagatggatatccgctatgacaacatgcacatcccaggcagccccctacagttctacgtg
gattatgtcaactgtggccatgtcacagcctatgggccaggcctcacccatggggtggtg
aataagcccgctatcttcaccgtcaacaccaaggatgcgggcgaggggggcttgtccctg
gccattgagggcccctccaaagcagagatcagctgcaccgacaaccaggatgggacgtgc
agtgtctcctacctgcccgtgttacctggtgactacagcatcctggtcaagtacaacgaa
cagcatatcccgggcagccccttcactgccagggtcacaggtgacgactccatgcgcatg
tcccacctgaaggtgggctctgccgccgacatccccatcaacatctcggagacggacctc
agcctgctgaccgccacagtggtgcccccctcgggccgggaagaaccctgtctgctgaag
cggctgcgcaacggccacgtggggatctcattcgtgcccaaggagacaggggaacacctg
gtgcacgtgaagaagaatgggcagcatgtggcaagcagccccattccggtggtgatcagc
caatcggagatcggggatgccagccgtgtgcgggtctcgggccagggcctccacgaaggc
cacacctttgagccagcagagtttatcattgatacacgtgatgcaggctatggggggctc
agcctgtccatcgagggtcccagcaaagtagacatcaacacagaggacctggaggatggc
acatgcagggtcacctactgccccacggagcctggcaactatatcatcaacatcaagttt
gctgaccagcacgtgcctggcagccccttctccgtgaaggtgacaggcgaggggcgtgtg
aaagagagcatcacgcgcaggcgacgggccccatcggtggctaatgttggcagtcactgt
gacctcagcctcaagatcccagaaattagcatccaggacatgacagcccaggtgactagc
ccatcaggcaagagccacgaggccgagattgtggaaggggagaaccatacctattgcatc
cgctttgtgccagctgagatgggcatgcacacggtcagcgtcaagtacaagggccagcac
gtgcccgggagccctttccagttcaccgtggggcccctgggggaagggggagcccacaag
gtccgtgccgggggccctggcctggaaagggctgaagctggagtgccagccgagttcagc
atttggacccgggaagctggcgcggggggcctggccattgctgtcgagggccccagcaag
gccgagatctccttcgaggaccgcaaggatggctcctgtggcgtggcttacgtggtccag
gagccaggtgactatgaggtgtcagtcaagttcaacgaggagcacatccccgatagccct
ttcgtggtgcctgtggcttctccgtctggtgacgcccgccgccttactgtttctagtctt
caggagtcagggctaaaggtcaaccagccagcctcttttgcagtcagcctgaatggggcc
aagggggcaatcgatgccaaggtgcacagcccctcaggagccctggaggagtgctatgtc
accgagatcgaccaagataagtacgctgtgcgctttatcccacgggagaatggcatctac
ctgattgatgtcaagttcaacggcacccacatcccggggagccccttcaagatccgagtt
ggggagcctgggcatggaggggacccaggcctggtgtctgcttatggagctggcttggaa
ggcggcatcacagggagcccagctgagtttatcgtgaacaccagcaatgcgggcgctggt
gccctctcagtcaccatcgacgggccttccaaggtgaagatggattgccaagagtgcccc
gagggctaccgcgtcacctacactcccatggcacctggcagctacctcatctccatcaag
tacggcggcccctaccacattgcgggcagccccttcaaggccagagtcacaggtcaccgc
ctcgtcagcaaccacagcctccatgagacatcatctgtgtttgtggactccctgaccaag
actgccaccatcccccagcacagtgccccaggcccgggtcccactgatgccagcaaggtg
ctggccaaaggcgtggggctgagcaaggcctacatgggccagaagagcagcttcacggtg
gactgcagcaaagcaggcaacaacatgctgctggtgggcgtgcatgggccccggacgccc
tgtgaagagatcctggtgaaacacgtgggcagcaggctctacagtgtgtcctacctgctc
aaggacaagggggagtacacgctggtggtcaagtggggtgacgagcacatcccgggcagc
ccctaccgagtcctggtgccctga

DBGET integrated database retrieval system