KEGG   Bos taurus (cow): 281210Help
Entry
281210            CDS       T01008                                 

Gene name
GPX3
Definition
(RefSeq) glutathione peroxidase 3
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
bta  Bos taurus (cow)
Pathway
bta00480  Glutathione metabolism
bta00590  Arachidonic acid metabolism
bta04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    281210 (GPX3)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    281210 (GPX3)
 Organismal Systems
  Endocrine system
   04918 Thyroid hormone synthesis
    281210 (GPX3)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     281210 (GPX3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-GeneID: 281210
NCBI-ProteinID: NP_776502
Ensembl: ENSBTAG00000043553
UniProt: P37141
Position
7
AA seq 226 aa AA seqDB search
MARLFRASCLLSLLLAGFIPPSQGQEKSKTDCHAGVGGTIYEYGALTIDGEEYIPFKQYA
GKYILFVNVASYUGLTGQYVELNALQEELEPFGLVILGFPCNQFGKQEPGENSEILATLK
YVRPGGGFTPNFQLFEKGDVNGEKEQKFYTFLKNSCPPTSELLGSPDRLFWEPMKVHDIR
WNFEKFLVGPDGIPIMRWYHRTTVNSVKMDILTYMRRRAVWEAKGK
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggcccggctcttccgggcatcctgccttctctccctgctcctggccggcttcattccc
ccgagccagggacaggagaagtcgaagacggactgccacgctggtgtgggtggcaccatc
tatgagtacggggccctcaccatcgatggggaggagtacatcccctttaagcagtacgct
ggcaaatacatcctcttcgtcaacgtggccagctactgaggcctgacgggccagtacgtt
gaactgaatgcactgcaggaagagcttgaaccatttggtctggtcattctgggcttcccc
tgcaaccaatttggaaaacaagaaccaggagagaactcggagatcctagccaccctcaag
tatgttcgaccaggtgggggcttcacccccaatttccaactgtttgagaaaggcgatgtg
aatggggagaaagagcagaagttctacacgttcctgaagaactcctgtcctcctacctcg
gagctcctaggctcacctgaccgccttttctgggaacccatgaaggtccatgacatccgg
tggaactttgagaagttcctggtggggccagacggcatccccatcatgcgctggtaccac
cgcaccacggtcaactctgtcaagatggacatcctgacctacatgcggcggcgggcggtc
tgggaggccaaggggaagtaa

DBGET integrated database retrieval system