KEGG   Bos taurus (cow): 281217Help
Entry
281217            CDS       T01008                                 

Gene name
GUK1
Definition
guanylate kinase 1 (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
bta  Bos taurus (cow)
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bta00230]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
7
AA seq 219 aa AA seqDB search
MLRRPLAGLAAAALGRALSDGMSGPRPVVLSGPSGAGKSTLLKKLLQEHGSIFGFSVSHT
TRDPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKAAVRAVQAMNRICV
LDVDLQGVRNIKKTDLRPIYIFVQPPSLDVLEQRLRQRNTETEESLAKRLAAARADMESS
KEPGLFDLIIVNDSLDKAYWALKEALSEEIKKAQGTGQS
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgctgcggcgcccgctggccgggctggcggcggccgcccttggccgggccctctcggac
gggatgtcaggaccaaggcccgttgtcctgagcggaccctcaggggctgggaagagcacc
ctactgaagaaactcctgcaggaacatggcagcatctttggcttcagcgtgtcccacacg
acaagggacccgaggccaggagaggagaacggcaaagattactactttgtgaccagggag
gtgatgcagcgcgacattgctgctggagacttcatcgagcacgctgagttctcagggaac
ttgtatgggaccagcaaggccgccgtgcgggccgtgcaggccatgaaccgcatctgcgtg
ctggacgtggacctgcagggcgtgcgcaacatcaagaagaccgacctgcggcccatctac
atcttcgtgcagccgccctcactggatgtcctggagcagcggctgcgacagcggaacaca
gagacagaggagagcctggccaagcgtctggcggctgcccgggctgacatggagagcagc
aaggagcccggcctgtttgacctgatcatcgtcaacgacagtctggacaaggcctactgg
gccctgaaggaggcgctctccgaggaaataaagaaggcccaaggcactggtcagtcctga

DBGET integrated database retrieval system