KEGG   Bos taurus (cow): 281237Help
Entry
281237            CDS       T01008                                 

Gene name
IFNG
Definition
interferon, gamma
Orthology
K04687  
interferon gamma
Organism
bta  Bos taurus (cow)
Pathway
Proteasome
Cytokine-cytokine receptor interaction
HIF-1 signaling pathway
Regulation of autophagy
TGF-beta signaling pathway
Osteoclast differentiation
Antigen processing and presentation
Jak-STAT signaling pathway
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
Type I diabetes mellitus
Salmonella infection
Leishmaniasis
Chagas disease (American trypanosomiasis)
African trypanosomiasis
Malaria
Toxoplasmosis
Amoebiasis
Tuberculosis
Measles
Influenza A
Herpes simplex infection
Epstein-Barr virus infection
Inflammatory bowel disease (IBD)
Systemic lupus erythematosus
Rheumatoid arthritis
Allograft rejection
Graft-versus-host disease
Class
Genetic Information Processing; Folding, sorting and degradation; Proteasome [PATH:bta03050]
Environmental Information Processing; Signal transduction; TGF-beta signaling pathway [PATH:bta04350]
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:bta04630]
Environmental Information Processing; Signal transduction; HIF-1 signaling pathway [PATH:bta04066]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:bta04060]
Cellular Processes; Transport and catabolism; Regulation of autophagy [PATH:bta04140]
Organismal Systems; Immune system; Natural killer cell mediated cytotoxicity [PATH:bta04650]
Organismal Systems; Immune system; Antigen processing and presentation [PATH:bta04612]
Organismal Systems; Immune system; T cell receptor signaling pathway [PATH:bta04660]
Organismal Systems; Development; Osteoclast differentiation [PATH:bta04380]
Human Diseases; Immune diseases; Systemic lupus erythematosus [PATH:bta05322]
Human Diseases; Immune diseases; Rheumatoid arthritis [PATH:bta05323]
Human Diseases; Immune diseases; Inflammatiory bowel disease (IBD) [PATH:bta05321]
Human Diseases; Immune diseases; Allograft rejection [PATH:bta05330]
Human Diseases; Immune diseases; Graft-versus-host disease [PATH:bta05332]
Human Diseases; Endocrine and metabolic diseases; Type I diabetes mellitus [PATH:bta04940]
Human Diseases; Infectious diseases; Salmonella infection [PATH:bta05132]
Human Diseases; Infectious diseases; Tuberculosis [PATH:bta05152]
Human Diseases; Infectious diseases; Measles [PATH:bta05162]
Human Diseases; Infectious diseases; Influenza A [PATH:bta05164]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:bta05168]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:bta05169]
Human Diseases; Infectious diseases; Amoebiasis [PATH:bta05146]
Human Diseases; Infectious diseases; Malaria [PATH:bta05144]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:bta05145]
Human Diseases; Infectious diseases; Leishmaniasis [PATH:bta05140]
Human Diseases; Infectious diseases; Chagas disease (American trypanosomiasis) [PATH:bta05142]
Human Diseases; Infectious diseases; African trypanosomiasis [PATH:bta05143]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q22-q24
AA seq 166 aa AA seqDB search
MKYTSYFLALLLCGLLGFSGSYGQGQFFREIENLKEYFNASSPDVAKGGPLFSEILKNWK
DESDKKIIQSQIVSFYFKLFENLKDNQVIQRSMDIIKQDMFQKFLNGSSEKLEDFKKLIQ
IPVDDLQIQRKAINELIKVMNDLSPKSNLRKRKRSQNLFRGRRAST
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatacaagctatttcttagctttactgctctgtgggcttttgggtttttctggt
tcttatggccagggccaattttttagagaaatagaaaacttaaaggagtattttaatgca
agtagcccagatgtagctaagggtgggcctctcttctcagaaattttgaagaattggaaa
gatgaaagtgacaaaaaaattattcagagccaaattgtctccttctacttcaaactcttt
gaaaacctcaaagataaccaggtcattcaaaggagcatggatatcatcaagcaagacatg
tttcagaagttcttgaatggcagctctgagaaactggaggacttcaaaaagctgattcaa
attccggtggatgatctgcagatccagcgcaaagccataaatgaactcatcaaagtgatg
aatgacctgtcaccaaaatctaacctcagaaagcggaagagaagtcagaatctctttcga
ggccggagagcatcaacgtaa

DBGET integrated database retrieval system