KEGG   Bos taurus (cow): 281373Help
Entry
281373            CDS       T01008                                 

Gene name
P4HB, PDI
Definition
prolyl 4-hydroxylase, beta polypeptide (EC:5.3.4.1)
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
bta  Bos taurus (cow)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:bta04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
19q22
AA seq 510 aa AA seqDB search
MLRRALLCLALTALFRAGAGAPDEEDHVLVLHKGNFDEALAAHKYLLVEFYAPWCGHCKA
LAPEYAKAAGKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFKNGDTASPKEYTA
GREADDIVNWLKKRTGPAASTLSDGAAAEALVESSEVAVIGFFKDMESDSAKQFFLAAEV
IDDIPFGITSNSDVFSKYQLDKDGVVLFKKFDEGRNNFEGEVTKEKLLDFIKHNQLPLVI
EFTEQTAPKIFGGEIKTHILLFLPKSVSDYEGKLSNFKKAAESFKGKILFIFIDSDHTDN
QRILEFFGLKKEECPAVRLITLEEEMTKYKPESDELTAEKITEFCHRFLEGKIKPHLMSQ
ELPDDWDKQPVKVLVGKNFEEVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHE
NIVIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLESGGQDGA
GDDDDLEDLEEAEEPDLEEDDDQKAVKDEL
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgccgcgctctgctctgcctggccctgaccgcgctattccgcgcgggtgccggc
gcccccgacgaggaggaccacgtcctggtgctccataagggcaacttcgacgaggcgctg
gcggcccacaagtacctgctggtggagttctacgccccatggtgcggccactgcaaggct
ctggccccggagtatgccaaagcagctgggaagctgaaggcagaaggttctgagatcaga
ctggccaaggtggatgccactgaagagtctgacctggcccagcagtatggtgtccgaggc
taccccaccatcaagttcttcaagaatggagacacagcttcccccaaagagtacacagct
ggccgagaagcggatgatatcgtgaactggctgaagaagcgcacgggccccgctgccagc
acgctgtccgacggggctgctgcagaggccttggtggagtccagtgaggtggccgtcatt
ggcttcttcaaggacatggagtcggactccgcaaagcagttcttcttggcagcagaggtc
attgatgacatccccttcgggatcacatctaacagcgatgtgttctccaaataccagctg
gacaaggatggggttgtcctctttaagaagtttgacgaaggccggaacaactttgagggg
gaggtcaccaaagaaaagcttctggacttcatcaagcacaaccagttgcccctggtcatt
gagttcaccgagcagacagccccgaagatcttcggaggggaaatcaagactcacatcctg
ctgttcctgccgaaaagcgtgtctgactatgagggcaagctgagcaacttcaaaaaagcg
gctgagagcttcaagggcaagatcctgtttatcttcatcgacagcgaccacactgacaac
cagcgcatcctggaattcttcggcctaaagaaagaggagtgcccggccgtgcgcctcatc
acgctggaggaggagatgaccaaatataagccagagtcagatgagctgacggcagagaag
atcaccgagttctgccaccgcttcctggagggcaagattaagccccacctgatgagccag
gagctgcctgacgactgggacaagcagcctgtcaaagtgctggttgggaagaactttgaa
gaggttgcttttgatgagaaaaagaacgtctttgtagagttctatgccccgtggtgcggt
cactgcaagcagctggcccccatctgggataagctgggagagacgtacaaggaccacgag
aacatagtcatcgccaagatggactccacggccaacgaggtggaggcggtgaaagtgcac
agcttccccacgctcaagttcttccccgccagcgccgacaggacggtcatcgactacaat
ggggagcggacactggatggttttaagaagttcctggagagtggtggccaggatggggcc
ggagatgatgacgatctagaagatcttgaagaagcagaagagcctgatctggaggaagat
gatgatcaaaaagctgtgaaagatgaactgtaa

DBGET integrated database retrieval system