KEGG   Bos taurus (cow): 281373Help
Entry
281373            CDS       T01008                                 

Gene name
P4HB, PDI
Definition
prolyl 4-hydroxylase, beta polypeptide (EC:5.3.4.1)
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
bta  Bos taurus (cow)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:bta00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    281373 (P4HB)
Enzymes [BR:bta01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     281373 (P4HB)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   281373 (P4HB)
  Exosomal proteins of colorectal cancer cells
   281373 (P4HB)
  Exosomal proteins of bladder cancer cells
   281373 (P4HB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
19q22
AA seq 510 aa AA seqDB search
MLRRALLCLALTALFRAGAGAPDEEDHVLVLHKGNFDEALAAHKYLLVEFYAPWCGHCKA
LAPEYAKAAGKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFKNGDTASPKEYTA
GREADDIVNWLKKRTGPAASTLSDGAAAEALVESSEVAVIGFFKDMESDSAKQFFLAAEV
IDDIPFGITSNSDVFSKYQLDKDGVVLFKKFDEGRNNFEGEVTKEKLLDFIKHNQLPLVI
EFTEQTAPKIFGGEIKTHILLFLPKSVSDYEGKLSNFKKAAESFKGKILFIFIDSDHTDN
QRILEFFGLKKEECPAVRLITLEEEMTKYKPESDELTAEKITEFCHRFLEGKIKPHLMSQ
ELPDDWDKQPVKVLVGKNFEEVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHE
NIVIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLESGGQDGA
GDDDDLEDLEEAEEPDLEEDDDQKAVKDEL
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgccgcgctctgctctgcctggccctgaccgcgctattccgcgcgggtgccggc
gcccccgacgaggaggaccacgtcctggtgctccataagggcaacttcgacgaggcgctg
gcggcccacaagtacctgctggtggagttctacgccccatggtgcggccactgcaaggct
ctggccccggagtatgccaaagcagctgggaagctgaaggcagaaggttctgagatcaga
ctggccaaggtggatgccactgaagagtctgacctggcccagcagtatggtgtccgaggc
taccccaccatcaagttcttcaagaatggagacacagcttcccccaaagagtacacagct
ggccgagaagcggatgatatcgtgaactggctgaagaagcgcacgggccccgctgccagc
acgctgtccgacggggctgctgcagaggccttggtggagtccagtgaggtggccgtcatt
ggcttcttcaaggacatggagtcggactccgcaaagcagttcttcttggcagcagaggtc
attgatgacatccccttcgggatcacatctaacagcgatgtgttctccaaataccagctg
gacaaggatggggttgtcctctttaagaagtttgacgaaggccggaacaactttgagggg
gaggtcaccaaagaaaagcttctggacttcatcaagcacaaccagttgcccctggtcatt
gagttcaccgagcagacagccccgaagatcttcggaggggaaatcaagactcacatcctg
ctgttcctgccgaaaagcgtgtctgactatgagggcaagctgagcaacttcaaaaaagcg
gctgagagcttcaagggcaagatcctgtttatcttcatcgacagcgaccacactgacaac
cagcgcatcctggaattcttcggcctaaagaaagaggagtgcccggccgtgcgcctcatc
acgctggaggaggagatgaccaaatataagccagagtcagatgagctgacggcagagaag
atcaccgagttctgccaccgcttcctggagggcaagattaagccccacctgatgagccag
gagctgcctgacgactgggacaagcagcctgtcaaagtgctggttgggaagaactttgaa
gaggttgcttttgatgagaaaaagaacgtctttgtagagttctatgccccgtggtgcggt
cactgcaagcagctggcccccatctgggataagctgggagagacgtacaaggaccacgag
aacatagtcatcgccaagatggactccacggccaacgaggtggaggcggtgaaagtgcac
agcttccccacgctcaagttcttccccgccagcgccgacaggacggtcatcgactacaat
ggggagcggacactggatggttttaagaagttcctggagagtggtggccaggatggggcc
ggagatgatgacgatctagaagatcttgaagaagcagaagagcctgatctggaggaagat
gatgatcaaaaagctgtgaaagatgaactgtaa

DBGET integrated database retrieval system