KEGG   Bos taurus (cow): 281414Help
Entry
281414            CDS       T01008                                 

Gene name
PNOC
Definition
(RefSeq) prepronociceptin
Organism
bta  Bos taurus (cow)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
8
AA seq 176 aa AA seqDB search
MKILFCDLLLLSLFSSVSSSCQKDCLVCREKLRPTLDSFSLEMCILECEEKAFTSPLWTP
CTKVMARGSWQLSPADPDHVAAALDQPRASEMQHLKRMPRVRSLFQRQKRTEPGLEEVGE
IEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQYLVLSMQSSQRRRTLHQNGNA
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcctgttttgtgacctcctgctgctcagcctcttctccagcgtgtccagcagc
tgtcagaaggactgtctggtctgcagagagaagctccgccccactcttgacagcttcagc
ctcgagatgtgcatccttgagtgtgaagagaaggccttcaccagccctctctggactcca
tgcaccaaggtcatggccaggggctcctggcagctcagccctgctgacccagaccacgtg
gcagctgctctggaccagcccagagcctctgagatgcagcatctgaagcgaatgccccgg
gtcaggagcctctttcaaaggcagaagaggacagagcccggcctggaggaggtgggggag
attgagcagaaacagctgcagaagcggttcgggggcttcaccggggcccggaagtcggcc
cggaagttggccaaccagaagcggttcagtgagtttatgcggcagtacctggtcctgagc
atgcagtccagccagcgtcggcgcaccctgcaccagaatggtaatgcgtag

DBGET integrated database retrieval system