KEGG   Bos taurus (cow): 281530Help
Entry
281530            CDS       T01008                                 

Gene name
THBS1, THBS
Definition
thrombospondin 1
Orthology
K16857  
thrombospondin 1
Organism
bta  Bos taurus (cow)
Pathway
Rap1 signaling pathway
p53 signaling pathway
Phagosome
PI3K-Akt signaling pathway
TGF-beta signaling pathway
Focal adhesion
ECM-receptor interaction
Malaria
Proteoglycans in cancer
MicroRNAs in cancer
Bladder cancer
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    281530 (THBS1)
   04350 TGF-beta signaling pathway
    281530 (THBS1)
   04151 PI3K-Akt signaling pathway
    281530 (THBS1)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    281530 (THBS1)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    281530 (THBS1)
  Cell growth and death
   04115 p53 signaling pathway
    281530 (THBS1)
  Cell communication
   04510 Focal adhesion
    281530 (THBS1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    281530 (THBS1)
   05205 Proteoglycans in cancer
    281530 (THBS1)
   05219 Bladder cancer
    281530 (THBS1)
  Infectious diseases
   05144 Malaria
    281530 (THBS1)
Heparan sulfate/heparin binding proteins [BR:bta00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  281530 (THBS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
10
AA seq 1170 aa AA seqDB search
MGLAWGLGVLLLLHACGSNRIPESGGDNSVFDIFELTGAARKRSGRRLVKGPDPSSPAFR
IEDANLIPPVPDKKFQDLVDAVRAEKGFLLLASLRQMKKTRGTLLAVERKDHSGQVFSVI
SNGKAGTLDLSLTVQGKQHVVSVEEALLATGQWKSITLFVQEDRAQLYIDCEKMENAELD
VPIQSIFTRDLASIARLRIAKGGVNDNFQGVLQNVRFVFGTTPEDILRNKGCSSSTSVFV
TLDNNVVNGSSPAIRTDYIGHKTKDLQAICGISCDELSSMVLELRGLRTIVTTLQDSIRK
VTEENKELANELRRPPLCYHNGVQYRTGDEWTVDSCTECRCQNSVTICKKVSCPIMPCSN
ATVPDGECCPRCWPSDSADDGWSPWSEWTSCSVTCGNGIQQRGRSCDSLNNRCEGSSVQT
RTCHIQECDKRFKQDGGWSHWSPWSSCSVTCGDGVITRIRLCNSPSPQMNGKPCEGKARE
TKACQKDSCPINGGWGPWSPWDICSVTCGGGVQKRSRLCNNPKPQFGGKDCVGDVTENQI
CNKQDCPIDGCLSNPCFAGVQCTSYPDGSWKCGACPPGYSGDGVECKDVDECKEVPDACF
NHNGEHRCENTDPGYNCLPCPPRFTGSQPFGRGVEHATANKQVCKPRNPCTDGTHDCNKN
AKCNYLGHYSDPMYRCECKPGYAGNGIICGEDTDLDGWPNEDLLCVANATYHCRKDNCPN
LPNSGQEDYDKDGIGDACDDDDDNDKIPDDRDNCPFHYNPAQYDYDRDDVGDRCDNCPYN
HNPDQADTDNNGEGDACAADIDGDSILNERDNCQYVYNVDQKDTDMDGVGDQCDNCPLEH
NPDQLDSDSDRIGDTCDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDACDHDDDN
DGIPDDRDNCRLVPNPDQKDSDGDGRGDACKDDFDQDKVPDIDDICPENVDISETDFRRF
QMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAVGYDEFNAVDFSGTFFINTERDD
DYAGFVFGYQSSSRFYVVMWKQVTQSYWDTNPTRAQGYSGLSVKVVNSTTGPGEHLRNAL
WHTGNTSGQVRTLWHDPRHIGWKDFTAYRWHLSHRPKTGFIRVVMYEGKKIMADSGPIYD
KTYAGGRLGLFVFSQEMVFFSDLKYECRDS
NT seq 3513 nt NT seq  +upstreamnt  +downstreamnt
atggggctggcctggggactcggtgtcctgctcctgttgcatgcctgcggctccaaccgc
attccagagtctgggggagacaacagtgtgtttgacatctttgaactcaccggagctgcc
cgcaagcggtctgggcgccgactggtgaagggccctgacccttctagcccagctttccgc
atcgaggatgccaacctgatcccccctgtgcctgacaagaagttccaagacctagtggat
gctgtgcgggcggagaaaggtttcctcctcctggcctccctgaggcaaatgaagaagacc
cggggtaccctgctggctgtggagcggaaagaccactctggccaggtcttcagcgtgatc
tccaatggcaaggcgggcaccctggacctgagcctgaccgtgcaggggaagcagcatgtg
gtgtcggtggaagaagcactcctggcgactggccagtggaagagcatcaccctgtttgtg
caggaggacagggcccagctgtacatcgactgtgagaagatggagaatgcggagctggat
gtccccatccagagcatcttcaccagggacctggccagcatcgccaggctccgcattgcc
aaaggaggtgtcaacgacaatttccagggggtgctgcagaatgtaaggtttgtctttgga
accacaccagaagacatcctcaggaacaaaggctgctccagctctaccagtgtctttgtc
acccttgacaacaacgtggtgaatgggtccagccctgccatccgcaccgactacattggc
cacaagacaaaggacctgcaagccatctgtggcatctcatgtgacgagctgtccagcatg
gtcctggagctcaggggtctacgcaccatcgtgaccacgctgcaggacagtatccgcaaa
gtgaccgaagagaacaaagagctggccaacgagctgaggaggcccccactctgctaccac
aacggagtgcagtacaggactggcgacgagtggacggtggacagctgcactgagtgtcgc
tgccagaactcagttaccatctgcaaaaaagtgtcctgtcccatcatgccctgctccaat
gccacagttccggatggagaatgctgcccacggtgctggcccagcgactctgcagacgat
ggctggtccccgtggtctgagtggacctcttgctctgtgacctgtggcaatggaatccag
cagcgtggccgctcctgcgacagcctcaacaacagatgcgagggctcctctgtgcagacg
cggacctgccacatccaggagtgtgacaagagatttaaacaggatggcggctggagccac
tggtccccatggtcatcttgctccgtaacatgtggagacggtgtgatcacaaggatccgg
ctctgcaactcccccagcccccagatgaatgggaagccatgtgagggcaaagcccgggag
accaaagcctgccagaaagactcctgccccatcaatggaggctggggaccttggtcacca
tgggacatctgttctgtcacctgtggaggaggggtacagaaacgtagccggctctgcaac
aaccccaaaccccagtttggaggcaaggactgcgttggtgatgtgacagaaaaccagatc
tgcaacaagcaggactgtcccattgacggatgcctgtccaatccctgctttgctggtgtc
cagtgtaccagctaccctgatggcagctggaagtgtggtgcctgtcccccaggctatagt
ggagatggagtcgagtgcaaagacgttgatgagtgcaaagaagtccctgatgcctgcttc
aaccacaatggagagcacaggtgtgagaacacagaccccggctacaactgcctgccctgc
ccaccgcgcttcactggctcgcagccctttggccggggcgtggaacatgccaccgccaac
aagcaggtatgcaagccccgaaacccctgcacagacgggacacacgactgcaacaagaac
gccaagtgcaactacctgggccactacagcgaccccatgtaccgctgcgagtgcaagcct
ggctacgccggcaacggcatcatctgcggggaggacacagacctggacggctggcccaat
gaggacctgctgtgcgtggccaacgcaacttaccactgcagaaaggataattgccccaac
cttcccaactcagggcaggaagactatgacaaggatggaatcggcgatgcctgcgatgat
gacgatgacaatgataagattccagatgacagggacaactgtccattccattacaaccca
gcccagtacgactatgacagagatgacgtgggagaccgctgtgacaactgcccctacaac
cacaacccagaccaggctgacacagataacaatggggaaggagacgcctgtgcagctgac
attgatggggacagtatcctcaatgaacgggacaactgccagtatgtctacaatgtggac
cagaaagacactgacatggacggggttggtgatcagtgtgacaactgccccctggaacac
aatccagaccagctcgactctgactcggaccgcattggagacacctgtgacaacaatcag
gatattgatgaagacggccaccagaacaatctggacaactgtccctacgtgcccaacgcc
aaccaggctgaccatgacaaggatggcaaaggcgatgcctgtgaccatgatgacgacaat
gatggcattcctgatgaccgggacaactgcaggctggtgcccaatcctgaccagaaggac
tctgatggtgatggtcgaggtgatgcttgcaaagatgattttgaccaggacaaggtgcca
gacattgatgacatctgtcccgaaaatgttgatatcagtgagactgatttccgccgattc
cagatgattcctctagatcccaaagggacatcccagaatgaccctaactgggttgtacgc
catcagggtaaagaactcgtccagactgtcaactgtgaccctggacttgctgtaggttat
gacgaatttaacgccgtggacttcagtggcaccttcttcatcaacaccgagagggatgac
gactatgccggctttgtgtttggctaccagtccagcagccgcttctatgttgtgatgtgg
aagcaagtcactcagtcctactgggacaccaaccccacgagggctcaggggtactctgga
ctttccgtgaaggttgtaaactccaccacggggcctggcgagcacctgcggaatgccctg
tggcacacaggaaacacctctggccaggtgcgcacactgtggcatgaccctcgtcacatt
ggctggaaagatttcactgcctacagatggcatctgagccacaggccaaagacaggtttc
atcagagtggtaatgtatgaagggaagaaaatcatggctgactcaggacccatctatgac
aaaacctatgctggtgggaggctaggcttgttcgtcttctctcaagaaatggtgttcttc
tccgacctgaaatatgaatgcagagactcctaa

DBGET integrated database retrieval system