KEGG   Bos taurus (cow): 281543Help
Entry
281543            CDS       T01008                                 

Gene name
TPI1
Definition
triosephosphate isomerase 1 (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bta  Bos taurus (cow)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    281543 (TPI1)
   01230 Biosynthesis of amino acids
    281543 (TPI1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    281543 (TPI1)
   00051 Fructose and mannose metabolism
    281543 (TPI1)
   00562 Inositol phosphate metabolism
    281543 (TPI1)
Enzymes [BR:bta01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     281543 (TPI1)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   281543 (TPI1)
  Exosomal proteins of bladder cancer cells
   281543 (TPI1)
  Exosomal proteins of melanoma cells
   281543 (TPI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
5
AA seq 249 aa AA seqDB search
MAPSRKFFVGGNWKMNGRKNNLGELINTLNAAKVPADTEVVCAPPTAYIDFARQKLDPKI
AVAAQNCYKVANGAFTGEISPGMIKDLGATWVVLGHSERRHVFGESDELIGQKVAHALAE
GLGVIACIGEKLDEREAGITEKVVFEQTKVIADNVKDWSKVVLAYEPVWAIGTGKTATPQ
QAQEVHEKLRGWLKSNVSDAVAQSARIIYGGSVTGATCKELASQPDVDGFLVGGASLKPE
FVDIINAKQ
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggcgccctccaggaagttcttcgttggggggaactggaagatgaacgggaggaagaac
aatctgggggaactcatcaacactctgaacgcggccaaggtgccagccgacaccgaggtg
gtttgcgcaccccccaccgcctacattgacttcgcccggcagaagctagatcccaagatt
gccgtggctgcgcagaactgttacaaagtggccaatggggcctttacgggggagatcagc
cctggcatgatcaaagatcttggagccacgtgggtagtcctggggcactccgagagaagg
catgtctttggggagtcagatgagctgattgggcagaaagtggcccatgccctggcagag
ggacttggagtgattgcctgcattggggagaagttagatgagagggaagctggcatcacg
gagaaggtcgttttcgagcaaaccaaggtcatcgcagataacgtgaaggattggagcaag
gttgtcttggcctatgagcctgtgtgggccattggtactggcaagacggcaacaccgcaa
caggcccaggaagtacacgaaaagctccggggatggcttaagtccaacgtctctgatgca
gtggctcagagcgcccgcatcatttatgggggttctgtgacgggggcaacctgcaaggag
ctggcaagccagcctgatgtggatggcttccttgtgggcggtgcttccctcaagcctgag
ttcgttgacatcatcaatgccaaacaataa

DBGET integrated database retrieval system